DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nach and F58G6.8

DIOPT Version :9

Sequence 1:NP_001334724.1 Gene:Nach / 36864 FlyBaseID:FBgn0024319 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001023246.2 Gene:F58G6.8 / 3565898 WormBaseID:WBGene00010278 Length:162 Species:Caenorhabditis elegans


Alignment Length:102 Identity:29/102 - (28%)
Similarity:49/102 - (48%) Gaps:10/102 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QEELKPEQVDLKVTPFVGYLRRTWSDFCATSSIHGLKYTRDEDTNKIVHLVWLLISVVMFICAVV 68
            |::|..|..|.:...|..:| :.|.:   |::|||:.:.....| .|..:||   |:::.:.||.
 Worm    38 QDKLHDETPDTRWIQFKNHL-KNWGE---TATIHGVPHMAQAHT-VIAIIVW---SIILIVSAVA 94

  Fly    69 MARTFYMDYRSSPTRMNVESD-NTPVNRLYFPPVTIC 104
            ....|| ...:|....||..: ||.::...||.:|.|
 Worm    95 FVYMFY-SIAASYLAFNVVVNLNTGLDSEPFPSITFC 130



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162303
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.