DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nach and egas-4

DIOPT Version :9

Sequence 1:NP_001334724.1 Gene:Nach / 36864 FlyBaseID:FBgn0024319 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_501207.2 Gene:egas-4 / 3564809 WormBaseID:WBGene00018906 Length:883 Species:Caenorhabditis elegans


Alignment Length:369 Identity:78/369 - (21%)
Similarity:134/369 - (36%) Gaps:89/369 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 LRWNCDEILYRCRFNGEIMDCSKIF-QLSKTFFGHCCSFNLRQKGWVNNKLNNLESFKVFHLNSL 238
            |.|...::.....:..:::|.:..| |.:....|:|.:||                    |:|| 
 Worm   577 LSWTAADMFLWVAYEQQLIDLNSNFVQWNDKVLGNCFTFN--------------------HMNS- 620

  Fly   239 NFTAQRAIGGLRYGLSVVVRYKDDNYDPLQSYSYGVKLLI---QEADAFPSA--HSAAKF---IA 295
            :|..:....|...||.:.:..|.|.|.| .:.:.||.:..   :||....|.  ::|..|   ||
 Worm   621 SFKYEARSSGYPGGLEMQMNVKQDEYLP-WTETAGVMVFTSTKEEAVTSESVRINTAPHFESRIA 684

  Fly   296 FNSETFAAVRPQETFCSSAVKALIIEERNCVFQNEFPMRYF-SDYVYPNCELNCRVTNMVKFCGC 359
            .|...:..:..:...|.::|             :|....|: .||....|..:|....:...|||
 Worm   685 INRVDYYRLGGRYGVCINSV-------------SEVKSYYYDGDYTTDGCLRSCYQDVVNGDCGC 736

  Fly   360 HTYFFD--FNRTSDRI-CTFRDIPC---LVDNFGRLLLICSKYSDFNRLLSANIITRKKST--QC 416
                .|  :...:|.| |:.....|   |||:.|                       ..||  :|
 Worm   737 ----MDPRYPMPNDGISCSISQKTCIDELVDSRG-----------------------DPSTWPEC 774

  Fly   417 YCPLTCEHIDYDVQLTNFPLELNMPVADKFYSGLAK------NDGVLHVFINSFSYRRLRRDLLS 475
            .|||.|....|..:|:..|....:...::.|:....      :..:|.:.:....|.........
 Worm   775 TCPLPCSQTVYTSKLSRLPYVNKIVDCEEAYTNKTACYETFLDSVILRISLPKLDYMIYSETPAM 839

  Fly   476 NMVTLVSNLGSAFSLFVGMSMLSVVEIIYYF---SVILRKNYKL 516
            ::...:|.||...|:.:|:|::|.||:.:.|   .|||..|.:|
 Worm   840 DLTKFMSYLGGILSILIGVSIVSFVELFFLFVQLIVILLFNKRL 883

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NachNP_001334724.1 None
egas-4NP_501207.2 EGF 101..131 CDD:278437
EGF_CA 482..522 CDD:238011
ASC <610..869 CDD:279230 67/320 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.