DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nach and ppk17

DIOPT Version :9

Sequence 1:NP_001334724.1 Gene:Nach / 36864 FlyBaseID:FBgn0024319 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster


Alignment Length:541 Identity:84/541 - (15%)
Similarity:166/541 - (30%) Gaps:192/541 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LLISVVMFICAVVMARTFYMDYRSSPTRMNVESDNTPVN---------RLYFPPVTICPDVLFNM 111
            |:..:|:|.|.:|:....|..:        .:..|.|::         .:..|.||||.:..:  
  Fly    18 LIRYLVLFACCIVVIVQLYECF--------AKLYNPPISTHSYYSLNETIEMPSVTICREPPY-- 72

  Fly   112 QKSEAFLNTLRLPKGAELRGILRKLHIFYGFMLDDERYSAEDIEQMEALLFLNNLTIPEFVEHLR 176
             |.|..   .||..||..........:.|.|                     ..:::.||.|:..
  Fly    73 -KEEVL---TRLSGGACPHPKYATCWMKYPF---------------------GEISLDEFFENST 112

  Fly   177 WNCDE--ILYRCR--FNGEIMDCSKIFQLSKTFFGHCCSFNLRQKGWVNNKLNNLESFKVFHLNS 237
            .:..:  :.|...  .|..:|:.|..|     :.|.|  :.||.|... .:::....:.:...:|
  Fly   113 HDSGDTFVFYGLNEDKNNVVMNSSLHF-----YMGRC--YTLRPKESA-KRVSKAVGYSIMLEHS 169

  Fly   238 LNFTAQRAIGGLRYGLSVVVRYKDDNYDPLQSYSYG-VKLLIQEADAFPSAHSAAKFIAFNSET- 300
            :..|:...:.....|..|.:..|.:|:..:.....| |:.:               |:..|.|. 
  Fly   170 MLTTSVSDVDTGSVGWHVFIHDKKENFTEINMKGSGRVEYV---------------FVGVNEEIE 219

  Fly   301 -------FAAVRPQETFCSSAVKALIIEERNCVFQNEFPMRYFSDYVYPNCELNCRVTNMVKFCG 358
                   |:.|:.:|..||        ::.|           :||       |.|          
  Fly   220 IKLQTQYFSNVQTREEACS--------DDEN-----------YSD-------LKC---------- 248

  Fly   359 CHTYFFDFNRTSDRICTFRDI-----------------PCLVDNFGRLLLICSKYSDFNRLLSAN 406
                        ...|.::|:                 || .|:.....|| |.|.|        
  Fly   249 ------------GEQCIWQDLADNMQCSGPWMHEIASEPC-NDSLSMRKLI-SDYKD-------- 291

  Fly   407 IITRKKSTQCYCPLTCEHIDYDVQLTNFPLELNMPVADKFYSGLAKNDGVLHVFINSFSYRRLRR 471
            :...:....|.|...|:...|...:.| ....|.|          :....::::..:.....:..
  Fly   292 VYENEDDFDCDCVQPCQSRIYTTFIQN-RKAFNQP----------EPRTQIYIYYTTKLISMIEE 345

  Fly   472 DLLSNMVTLVSNLGSAFSLFVGMSMLSVVEIIYYFSVIL----------RKNYKLEC-------E 519
            ....:....::::|.:....:|:|:|.::.|:.:..:..          ::..|||.       :
  Fly   346 RPSYDTTQFIADVGGSLGFLLGLSVLGLIGILEHMMLFFCGGFIKRMQQKEQAKLEANSEDGQSQ 410

  Fly   520 TRSQML---------HKKPKF 531
            |..:.:         .|:||:
  Fly   411 TSDETIDVEIAYKKKEKQPKY 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NachNP_001334724.1 None
ppk17NP_001285988.1 ASC 11..358 CDD:295594 72/466 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456709
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.