DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nach and ppk3

DIOPT Version :9

Sequence 1:NP_001334724.1 Gene:Nach / 36864 FlyBaseID:FBgn0024319 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_726336.1 Gene:ppk3 / 246504 FlyBaseID:FBgn0050181 Length:535 Species:Drosophila melanogaster


Alignment Length:542 Identity:123/542 - (22%)
Similarity:212/542 - (39%) Gaps:130/542 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CATSSIHGLKYTRDEDTNKIVHLVWLLISVVMFICAVVMARTFYMDYRSSPTRMNVESDNTPVNR 95
            |...|||.|:           .|.||.:.|...|.|:|::|.....|.||||.::|:.|....|.
  Fly    58 CVNRSIHLLE-----------RLFWLAVVVSSVIAALVLSRLQLERYFSSPTVISVDRDYRGWNG 111

  Fly    96 LYFPPVTICPDVLFNMQKSEAFLNTLRLPKGAELRGILRKLHIFYGFMLDDERYSAEDIEQMEAL 160
             ..|.||:|.....:..|:..::..:                  :...:.||.|    ...|:.|
  Fly   112 -SLPAVTLCYYDHIDSFKANEYIQEM------------------WNVSIIDEDY----FYFMDFL 153

  Fly   161 LFLNNLTIPEFVEHLRWNCDEILYRCRFNGEIMDCSKIFQ-LSKTFFGHCCSFNLRQKGWVNNKL 224
            ..:.|.|...:.|..::..||     ||  :.:|..::.| :.:.|.....||:           
  Fly   154 YAVVNATAGNYAELAKFAEDE-----RF--DQIDLYEMIQRVDRPFEQVISSFD----------- 200

  Fly   225 NNLESFKVFHLNSLNFTAQRAIGGLRYGLSVVVRYKDDNYD----PLQSYSYG-----VKLLIQE 280
               ..|:| |:..: .|.:.|...:...:|.|:..:...|:    || |..||     :::.:.|
  Fly   201 ---AGFQV-HVQRV-MTERGACYAINSPMSTVLSGQPVAYELMPQPL-SCQYGKQQCYIRMDLYE 259

  Fly   281 ADAFPSAHS-------AAKFIAF--NSETFAAVRPQETFCSSAVKALIIEERNCVFQNE--FPMR 334
            :......||       .|..:|.  :.|..|:.:..||..|..::.|.:.:|.|||.||  ..::
  Fly   260 STGVLDVHSPFEVSATEANIVALHKSDEITASFKVLETVASKNLRQLSVAQRKCVFNNEETSNLK 324

  Fly   335 YFSDYVYPNCELNCRVTNMVKFCGCHTYFFDFNRTSDRICTFRDIPCLVDNFGRLLLICSKYSDF 399
            .:|..:   |...||....::.|.|..:|:.:  .....|......||:              ||
  Fly   325 IYSKSL---CLARCRAVMALEMCNCVPFFYPY--VDGPSCNPAGFECLL--------------DF 370

  Fly   400 NRLLSANIITRKKSTQCYCPLTCEHIDYDVQLTNFPLELNMPVADKFYSGLAKNDGVLHVFINSF 464
            ...:.|..|       |.||.||..|:|.:|           ...|...|:..|:.|......:.
  Fly   371 KWPIWALHI-------CKCPSTCTEIEYTMQ-----------TVKKSSWGVKNNEEVASSETATS 417

  Fly   465 SYR--------RLRRDLLSNMVTLVSNLGSAFSLFVGMSMLSVVEIIYYFSVILRKNYKLECETR 521
            |:|        |:|||::.:...||.:.|...:||||:|::.:||:::    :|..|..|:..|.
  Fly   418 SFRWDLIPPKVRMRRDVVYSFEDLVVSFGGVLALFVGVSVMGLVEMVH----VLVNNLLLDVFTL 478

  Fly   522 SQMLHKKPKFAWPKANDTHSKE 543
            .:::..:.:..|.:  |.|.:|
  Fly   479 LRLMLGRLRRCWRR--DDHMRE 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NachNP_001334724.1 None
ppk3NP_726336.1 ASC 59..464 CDD:279230 114/499 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.