DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nach and Asic4

DIOPT Version :9

Sequence 1:NP_001334724.1 Gene:Nach / 36864 FlyBaseID:FBgn0024319 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_036020902.1 Gene:Asic4 / 241118 MGIID:2652846 Length:586 Species:Mus musculus


Alignment Length:563 Identity:113/563 - (20%)
Similarity:207/563 - (36%) Gaps:131/563 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RTWSDFCATSSIHGLKYTRDEDTNKIVHLVWLLISVVMFICAVVMARTFYMDYRSSPTRMNVESD 89
            |..:.|.:||::|||........:.:...:|.|..:......:..|.:....|.:.|..:.:: .
Mouse    40 RDLATFASTSTLHGLGRACGPGPHGLRRTLWALALLTSLAAFLYQAASLARGYLTRPHLVAMD-P 103

  Fly    90 NTPVNRLYFPPVTICPDVLFNMQK------SEAFLNTLRLPKGAELRGILRKLHIFYGFMLDDER 148
            ..|.....||.||:|     |:.:      |:|.:..|     |.|.|:..|         |.:.
Mouse   104 AAPAPVAGFPAVTLC-----NINRFRHSALSDADIFHL-----ANLTGLPPK---------DRDG 149

  Fly   149 YSAEDIEQMEALLFLNNLTIPEFVEHLR---WNCDEILYRCRFNGEIMDCSKIFQLSKTFFGHCC 210
            :.|..:...|          |:.|:.|.   ....::|..|.|:|.....|. |.:..|.:|.|.
Mouse   150 HRAAGLRYPE----------PDMVDILNRTGHQLADMLKSCNFSGHHCSASN-FSVVYTRYGKCY 203

  Fly   211 SFNLRQKGWVNNKLNNLESFKVFHLNSLNFTAQRAIGGLRYGLSVVVRYKDDNYDPL------QS 269
            :||.       :..::|.|              || ||:..||.:::..:.:.|.|:      .|
Mouse   204 TFNA-------DPQSSLPS--------------RA-GGMGSGLEIMLDIQQEEYLPIWRETNETS 246

  Fly   270 YSYGVKLLIQEADAFPSAHSAAKFIAFNSETFAAVRPQETFCSSAVKALIIEERNCVFQNEF--- 331
            :..|:::.|...:..|..|.....::...:||.:.:.|.      :..|.....||..::|.   
Mouse   247 FEAGIRVQIHSQEEPPYIHQLGFGVSPGFQTFVSCQEQR------LTYLPQPWGNCRAESELREP 305

  Fly   332 PMRYFSDYVYPNCELNCRVTNMVKFCGCHTYFFD-------------FNRTSDRICTFRDIPCLV 383
            .::.:|.|....|.|.|....:::.|.|......             .:|||.|....|.....:
Mouse   306 ELQGYSAYSVSACRLRCEKEAVLQRCHCRMVHMPGGHLQPVFGATLLSSRTSRRQRCMRTTCTRI 370

  Fly   384 DNFGRLLLICSKYSDFNR--LLSANI-----------ITRKKSTQCYCPLTCEHIDYDVQLTNFP 435
            ....|:|:..|.|.....  :...||           :.......|:||..|       .||.:.
Mouse   371 YTHERVLMCMSGYLHMGNETICPPNIYIECADHTLDSLGGGSEGPCFCPTPC-------NLTRYG 428

  Fly   436 LELNMP----------VADKFYSG---LAKNDGVLHVFINSFSYRRLRRDLLSNMVTLVSNLGSA 487
            .|::|.          :|.|:...   :.:|..||.||..:.:...:.:.....:..|:.:||..
Mouse   429 KEISMVKIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTSEAMEQQAAYGLSALLGDLGGQ 493

  Fly   488 FSLFVGMSMLSVVEIIYYFSVILRKNYKLECETRSQMLHKKPK 530
            ..||:|.|:|:::||:.|.       |::..: |.:.:.::||
Mouse   494 MGLFIGASILTLLEILDYI-------YEVSWD-RLKRVWRRPK 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NachNP_001334724.1 None
Asic4XP_036020902.1 ASC 40..535 CDD:413546 113/563 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842198
Domainoid 1 1.000 108 1.000 Domainoid score I6420
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8693
orthoMCL 1 0.900 - - OOG6_100105
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.