DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nach and mec-4

DIOPT Version :9

Sequence 1:NP_001334724.1 Gene:Nach / 36864 FlyBaseID:FBgn0024319 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_510712.2 Gene:mec-4 / 181728 WormBaseID:WBGene00003168 Length:768 Species:Caenorhabditis elegans


Alignment Length:382 Identity:87/382 - (22%)
Similarity:140/382 - (36%) Gaps:86/382 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 EHLRWNCDEILYRCRFNGEIMDCSKIFQLS-KTFFGHCCSFNLRQKGWVNNKLNNLESFKVFHLN 236
            |.|.....|::::|.|||:..|....|... ...||.|.:||                    |..
 Worm   437 ERLSTTKRELVHKCSFNGKACDIEADFLTHIDPAFGSCFTFN--------------------HNR 481

  Fly   237 SLNFTAQRAIGGLRYGLSVVVRYKDDNYDPLQSYSYGVKLLIQEADAFPSAHSAAKFIAFNSETF 301
            ::|.|:.||  |..|||.::|.....:|.| .:.:.||:|.|.:.:.||.           .:||
 Worm   482 TVNLTSIRA--GPMYGLRMLVYVNASDYMP-TTEATGVRLTIHDKEDFPF-----------PDTF 532

  Fly   302 AAVRPQETFCSSAVKALIIEERNCVFQNEFPMRYFSDYVYPN-------CELNCRVTNMVKFCGC 359
            ....|.....|..::...:......:.:..|....|||:|.|       |..:|....::|.|.|
 Worm   533 GYSAPTGYVSSFGLRLRKMSRLPAPYGDCVPDGKTSDYIYSNYEYSVEGCYRSCFQQLVLKECRC 597

  Fly   360 HTYFFDFNRTSDRICTFRDIP----CLVDNFGRLLLICSKYSDFNRLLSANIITRKKSTQCYCPL 420
            ....|.....: |.|...| |    ||          .::.:|...|        ..|.:|.|..
 Worm   598 GDPRFPVPENA-RHCDAAD-PIARKCL----------DARMNDLGGL--------HGSFRCRCQQ 642

  Fly   421 TCEHIDYDVQLT--NFP-LELNMPV---------ADKFYSGLAKNDGVLHVFINSFSYRRLRRDL 473
            .|....|.|..:  .:| |.|.:.:         .:|.|.   :|..::.||....::..|....
 Worm   643 PCRQSIYSVTYSPAKWPSLSLQIQLGSCNGTAVECNKHYK---ENGAMVEVFYEQLNFEMLTESE 704

  Fly   474 LSNMVTLVSNLGSAFSLFVGMSMLSVVEIIYYFSVILRKNYKLECETRSQMLHKKPK 530
            ....|.|:::.|....|:.|:|.|:..|.::.|   |...| :..| .:..|:||.|
 Worm   705 AYGFVNLLADFGGQLGLWCGISFLTCCEFVFLF---LETAY-MSAE-HNYSLYKKKK 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NachNP_001334724.1 None
mec-4NP_510712.2 deg-1 86..736 CDD:273309 79/355 (22%)
ASC 87..>172 CDD:279230
ASC <428..739 CDD:295594 80/361 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162289
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100105
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.