DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nach and deg-1

DIOPT Version :9

Sequence 1:NP_001334724.1 Gene:Nach / 36864 FlyBaseID:FBgn0024319 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001360706.1 Gene:deg-1 / 181035 WormBaseID:WBGene00000950 Length:844 Species:Caenorhabditis elegans


Alignment Length:362 Identity:81/362 - (22%)
Similarity:132/362 - (36%) Gaps:108/362 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 EILYRCRFNGEIMDCSKIFQLS-KTFFGHCCSFNLRQKGWVNNKLNNLESFKVFHLNSLNFTAQR 244
            |.:..|.|||:..|..:.|:|. ...||:|.:||..    |||                |:|:.|
 Worm   500 EFIEMCSFNGKECDIDEDFRLHVDPEFGNCFTFNYD----VNN----------------NYTSSR 544

  Fly   245 AIGGLRYGLSVVVRYKDDNYDPLQSYSYGVKLLIQEADAFPSAHSAAKFIAFNSETFAAVRPQET 309
            |  |..||:.|::.....:| ...|.|.||:|.|.....:|.           .:||....|...
 Worm   545 A--GPMYGIRVLLFVNTSDY-MSTSESSGVRLAIHPPTEYPF-----------PDTFGYSAPVGF 595

  Fly   310 FCSSAVKALI-----------IEERNCVFQNEFPMRYFSDYVYPNCELNCRVTNMVKFCGC---- 359
            ..|..:|..:           :|.:..|.:|.....|  ||....|..:|....::..|.|    
 Worm   596 ASSFGIKKKVMQRLPAPYGECVETKKVVDRNYIYAGY--DYHPEGCHRSCFQNGLIDDCSCGDPR 658

  Fly   360 ------HTYFFDFNRTSDRICTFRDIPCLVDNFGRLLLICSKYSDFNRLLSANIITRKKSTQCYC 418
                  :.:...||.|:.        .||..|.|.:       .||:.:       .:|..:|.|
 Worm   659 FPVPEGYRHCSAFNATAR--------TCLEKNIGSV-------GDFHHI-------TQKMDKCVC 701

  Fly   419 PLTCEHIDYDVQLTNFPLELNMPVADKFYSG---LAKNDG---------------VLHVFINSFS 465
            ..:||.|.::|..:          ..|:.||   |...||               ::.||....:
 Worm   702 KQSCEEIIHEVTFS----------CSKWPSGATDLGDCDGMTESECEQYYRLNAAMIEVFYEQLN 756

  Fly   466 YRRLRRDLLSNMVTLVSNLGSAFSLFVGMSMLSVVEI 502
            |..|:......:|.|:::.|....|::|.|:::|:|:
 Worm   757 YELLQESEAYGLVNLIADFGGHLGLWLGFSVITVMEV 793

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NachNP_001334724.1 None
deg-1NP_001360706.1 deg-1 58..796 CDD:273309 81/362 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100105
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.