DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nach and LOC103910008

DIOPT Version :9

Sequence 1:NP_001334724.1 Gene:Nach / 36864 FlyBaseID:FBgn0024319 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_009296668.1 Gene:LOC103910008 / 103910008 -ID:- Length:99 Species:Danio rerio


Alignment Length:58 Identity:19/58 - (32%)
Similarity:30/58 - (51%) Gaps:13/58 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 LFVGMSMLSVVEII-YYFSVILRKNYKLECETRSQMLHKKPKFAWPKANDTHSKEQKS 546
            ||:|.|:|:::||: |.:.||   .::||...|.|...||         .|..::|.|
Zfish     3 LFIGASVLTILEILDYVYEVI---KHRLERLLRPQRDDKK---------QTQQQQQAS 48

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NachNP_001334724.1 None
LOC103910008XP_009296668.1 ASC <1..32 CDD:295594 12/31 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.