DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amyrel and IMA5

DIOPT Version :9

Sequence 1:NP_477262.1 Gene:Amyrel / 36863 FlyBaseID:FBgn0020506 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_012319.1 Gene:IMA5 / 853214 SGDID:S000003752 Length:581 Species:Saccharomyces cerevisiae


Alignment Length:515 Identity:93/515 - (18%)
Similarity:160/515 - (31%) Gaps:197/515 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 HNPHWWGNRNTIVHLF--EWK------WSDIAQECE--SFLGPRGFAGVQVSPVNENILSAGRPW 75
            |||.|| ...|:..::  .:|      |.|:|....  .::...|...:.|.|..::      |.
Yeast     5 HNPKWW-KEATVYQIYPASFKDSNNDGWGDLAGITSKLDYVKELGVDAIWVCPFYDS------PQ 62

  Fly    76 WER-YQPISY-KLTTRSGNEEEFGDMVRRCNDVGVRIYVDVLLNHMSGDFDGVAVGTAGTEAEPS 138
            .:. |...:| |:..|.|..|:...|:...:..|:::.||:::||.|.:.:... .:..::|.|.
Yeast    63 EDMGYDIANYEKVWPRYGTNEDCFQMIEEAHKRGIKVIVDLVINHCSEEHEWFK-ESRSSKANPK 126

  Fly   139 KKSF----------PGVPYTAQDFHPTCEITDWNDRFQVQQCEL------VGLKDLDQSSDWVRS 187
            :..|          .|.|....::......:.|  |:..:..|.      :|..|.:..::..|.
Yeast   127 RDWFFWRPPKGYDEKGNPIPPNNWRSFFGGSAW--RYDEKTGEFFLHVFALGQPDFNWENEECRK 189

  Fly   188 KLIE-----FLDHLIELGVAGFRVDAAKHMASEDLEYIYSSLSNLN----IDHGFPHNSRPFIF- 242
            .:.:     :|.|    .|.|||:|...         :||.:..|.    .|...|:......| 
Yeast   190 AIYDSSVGYWLRH----NVDGFRIDVGS---------MYSKVEGLPDAPITDPTVPYQKGTEFFI 241

  Fly   243 ---------QEVIDHGHETVSRDEYKDLGAVTEFRFSEEIGNAFRGNNALKWLQSWGTDWGFLPS 298
                     :|:  |.:......|.|::..|.|.....|  :.||...:.|              
Yeast   242 NGPRIHEYHKEM--HNYMLSQVPEGKEIMTVGEVGIGNE--DDFRVYTSAK-------------- 288

  Fly   299 GQALTFVDNHDNQRDAGAVLNYK------SP-----------RQYKMATAFHLAYPYGISRVMSS 346
                        :.:...:.|:|      :|           :.:|:|.|             .|
Yeast   289 ------------EGELNMMFNFKHTSVGENPKCKYELIPFTLKDFKLALA-------------ES 328

  Fly   347 FAF------------DDHDTPPPQDAQERIISPEFDADGACVNGWICEHRWRQI----------- 388
            |.|            ::||.|       |.:| .|.:|..         :||:|           
Yeast   329 FLFIENTDCWSTIYLENHDQP-------RSVS-RFGSDSP---------KWREISSKMLATLIIS 376

  Fly   389 ------------YAMVGFKNAVRDTEITGWWDNGDNQISFCRGNKGFLAINNNLYDLSQD 436
                        ..|..|||  |..|          ||....|...:.||..   |..:|
Yeast   377 LTGTVFIYQGQELGMPNFKN--RKIE----------QIKCVEGTGTYAAIKR---DYGED 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmyrelNP_477262.1 AmyAc_bac_euk_AmyA 29..398 CDD:200456 79/467 (17%)
Aamy_C 404..492 CDD:214749 7/33 (21%)
IMA5NP_012319.1 AmyAc_SI_OligoGlu_DGase 11..498 CDD:200472 88/508 (17%)
Malt_amylase_C 509..>548 CDD:413446
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342144
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.