DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amyrel and MAL12

DIOPT Version :9

Sequence 1:NP_477262.1 Gene:Amyrel / 36863 FlyBaseID:FBgn0020506 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_011808.3 Gene:MAL12 / 853209 SGDID:S000003524 Length:584 Species:Saccharomyces cerevisiae


Alignment Length:408 Identity:86/408 - (21%)
Similarity:147/408 - (36%) Gaps:134/408 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSLAQH---NPHWWGNRNTIVHLF--EWK------WSD---IAQECESFLGPRGFAGVQVSPVNE 66
            ::::.|   .|.|| ...||..::  .:|      |.|   |..:.: ::...|...:.|.|..:
Yeast     1 MTISDHPETEPKWW-KEATIYQIYPASFKDSNNDGWGDLKGITSKLQ-YIKDLGVDAIWVCPFYD 63

  Fly    67 NILSAGRPWWERYQPIS--YKLTTRSGNEEEFGDMVRRCNDVGVRIYVDVLLNHMSGDFDGVAVG 129
            :      |..:....||  .|:....|..|:..:::.:.:.:|::...|:::||.|.:.:.....
Yeast    64 S------PQQDMGYDISNYEKVWPTYGTNEDCFELIDKTHKLGMKFITDLVINHCSTEHEWFKES 122

  Fly   130 TA----------------GTEAE-----PSK-KSFPG-----VPYTAQDFHPTCEITDWNDRFQV 167
            .:                |.:||     |:. |||.|     ...|..:|:...        |..
Yeast   123 RSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSFFGGSAWTFDETTNEFYLRL--------FAS 179

  Fly   168 QQCELVGLKDLDQSSDWVRSKLIE-----FLDHLIELGVAGFRVDAA----KHMASEDLEYIYSS 223
            :|.      ||:..::..|..:.|     :|||    ||.|||:|.|    |.....| ..|:..
Yeast   180 RQV------DLNWENEDCRRAIFESAVGFWLDH----GVDGFRIDTAGLYSKRPGLPD-SPIFDK 233

  Fly   224 LSNLNIDHGFPHNS----------RPFIFQEVID-----------HG-----HETVSRDEYKDLG 262
            .|.|...:...||.          ..|:...|.|           ||     :.:.:|.|..:: 
Yeast   234 TSKLQHPNWGSHNGPRIHEYHQELHRFMKNRVKDGREIMTVGEVAHGSDNALYTSAARYEVSEV- 297

  Fly   263 AVTEFRFSE-EIGNA--FRGNNALKWLQSW------------GTD-WGFLPSGQALTFVDNHDNQ 311
                |.|:. |:|.:  ||.|.....|:.|            ||| |       |.|:::|||..
Yeast   298 ----FSFTHVEVGTSPFFRYNIVPFTLKQWKEAIASNFLFINGTDSW-------ATTYIENHDQA 351

  Fly   312 RDAGAVLNYKSPRQYKMA 329
            |......: .||:..|::
Yeast   352 RSITRFAD-DSPKYRKIS 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmyrelNP_477262.1 AmyAc_bac_euk_AmyA 29..398 CDD:200456 82/392 (21%)
Aamy_C 404..492 CDD:214749
MAL12NP_011808.3 AmyAc_SI_OligoGlu_DGase 15..501 CDD:200472 82/393 (21%)
Malt_amylase_C 511..583 CDD:406946
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342142
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.