DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amyrel and AMY2

DIOPT Version :9

Sequence 1:NP_477262.1 Gene:Amyrel / 36863 FlyBaseID:FBgn0020506 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001323338.1 Gene:AMY2 / 843945 AraportID:AT1G76130 Length:413 Species:Arabidopsis thaliana


Alignment Length:499 Identity:102/499 - (20%)
Similarity:165/499 - (33%) Gaps:173/499 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 HNPHWWGNRNTIVHLFEWKWSDIAQECESFLGPRGFAGVQVSPVNENILSAGRPWWERYQPIS-Y 84
            |...||.|       .:.|..|||:.        ||....:.|.::::...|      |.|.. |
plant    37 HKYDWWRN-------LDGKVPDIAKS--------GFTSAWLPPPSQSLAPEG------YLPQDLY 80

  Fly    85 KLTTRSGNEEEFGDMVRRCNDVGVRIYVDVLLNHMSGD----------FDGVAVG---------T 130
            .|.:..|:|.....::|:.....||...|:::||..|.          :||:::.         |
plant    81 SLNSAYGSEHLLKSLLRKMKQYKVRAMADIVINHRVGTTRGHGGMYNRYDGISLPWDEHAVTSCT 145

  Fly   131 AGTEAEPSKKSFPGVPYTAQDFHPTCEITDWNDRFQVQQCELVGLKDLDQSSDWVRSKLIEFLDH 195
            .|.....:..:|.|||                              ::|.:..:||..:|.:|..
plant   146 GGLGNRSTGDNFNGVP------------------------------NVDHTQHFVRKDIIGWLRW 180

  Fly   196 LIE-LGVAGFRVDAAK-HMASEDLEYIYSSLSNLNI----------DHGFPHNSRPFIFQEVIDH 248
            |.. :|...||.|.|: :.|:...|||.::....::          .||..:|..        .|
plant   181 LRNTVGFQDFRFDFARGYSANYVKEYIGAAKPLFSVGECWDSCNYNGHGLDYNQD--------SH 237

  Fly   249 GHETVS-RDEYKDLGAVTEFRFSEEIGNAFRGNNALKWLQSW----------GTDWGFLPSGQAL 302
            ....:| .|....:.|..:|.....:..|.:|       |.|          |. .|:.|| :|:
plant   238 RQRIISWIDATGQISAAFDFTTKGILQEAVKG-------QYWRLCDAQGKPPGV-MGWWPS-RAV 293

  Fly   303 TFVDNHDNQRDAGAVLNYKSPRQYKM-ATAFHLAYPYGISRVMSSFAFDDHDTPPPQDAQERIIS 366
            ||:||||.   .....::..|..:.| ..|:.|.:| ||..|     |.||              
plant   294 TFLDNHDT---GSTQAHWPFPSHHVMEGYAYILTHP-GIPCV-----FYDH-------------- 335

  Fly   367 PEFDADGACVNGWICEHRWRQIYAMVGFKNAVRDTEITGWWDNGDNQISFCRGNKGFLAINNNLY 431
              |...|:.::.        ||..::..:.               .|....|.....|...:|||
plant   336 --FYDWGSSIHD--------QIVKLIDIRR---------------RQDIHSRSTVRVLKAESNLY 375

  Fly   432 DLSQDLNTCLPAGTYCDVISGSLIDGS-C-TGKSVTVNENGYGY 473
            ........|:..|           ||| | :|:..|:..:|:.|
plant   376 AAIVGEKICMKLG-----------DGSWCPSGRDWTLATSGHRY 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmyrelNP_477262.1 AmyAc_bac_euk_AmyA 29..398 CDD:200456 82/412 (20%)
Aamy_C 404..492 CDD:214749 16/72 (22%)
AMY2NP_001323338.1 PLN02361 15..413 CDD:177990 102/499 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2673
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D665362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.