DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amyrel and AMY3

DIOPT Version :9

Sequence 1:NP_477262.1 Gene:Amyrel / 36863 FlyBaseID:FBgn0020506 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_564977.1 Gene:AMY3 / 843319 AraportID:AT1G69830 Length:887 Species:Arabidopsis thaliana


Alignment Length:373 Identity:85/373 - (22%)
Similarity:139/373 - (37%) Gaps:116/373 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FEW------KWSDIAQECESFLGPRGFAGVQVSPVNENILSAGRPWWERYQPIS-YKLTTRSGNE 93
            |.|      :|....||....|...||..:.:.|..|::...|      |.|.. |.|.:|.|..
plant   502 FNWESNKSGRWYLELQEKADELASLGFTVLWLPPPTESVSPEG------YMPKDLYNLNSRYGTI 560

  Fly    94 EEFGDMVRRCNDVGVRIYVDVLLNHMSGDF---DGVAVGTAGTEAEPSKKSFPGVPYTAQDFHPT 155
            :|..|.|::.:.||:::..|.:|||....|   :||.....|.                      
plant   561 DELKDTVKKFHKVGIKVLGDAVLNHRCAHFKNQNGVWNLFGGR---------------------- 603

  Fly   156 CEITDWNDR--------FQVQQCELVG-----LKDLDQSSDWVRSKLIEFLDHLI-ELGVAGFR- 205
               .:|:||        ||.:..:..|     ..::|.|.|:||..:.|:|..:: |:|..|:| 
plant   604 ---LNWDDRAVVADDPHFQGRGNKSSGDNFHAAPNIDHSQDFVRKDIKEWLCWMMEEVGYDGWRL 665

  Fly   206 --------------VDAAKHMAS-----EDLEYIYSSLSNLNIDHGFPHNSRPFIFQEVIDHGHE 251
                          :||:|...:     :.|.|.|..: :.|.|   .|.      |.::|..:.
plant   666 DFVRGFWGGYVKDYMDASKPYFAVGEYWDSLSYTYGEM-DYNQD---AHR------QRIVDWINA 720

  Fly   252 TVSRDEYKDLGAVTEFRFSEEIGNAFRG--NNALKWLQSWGTD---------WGFLPSGQALTFV 305
            |        .||...|..:.      :|  :.||:..:.|...         .|:.|| :|:||:
plant   721 T--------SGAAGAFDVTT------KGILHTALQKCEYWRLSDPKGKPPGVVGWWPS-RAVTFI 770

  Fly   306 DNHDNQRDAGAVLNYKSPRQYKM-ATAFHLAYPYGISRVMSSFAFDDH 352
            :|||.....|   :::.|...:| ..|:.|.:| |...|.....|.|:
plant   771 ENHDTGSTQG---HWRFPEGKEMQGYAYILTHP-GTPAVFFDHIFSDY 814

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmyrelNP_477262.1 AmyAc_bac_euk_AmyA 29..398 CDD:200456 85/373 (23%)
Aamy_C 404..492 CDD:214749
AMY3NP_564977.1 PLN02784 1..887 CDD:215419 85/373 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D665362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.