DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amyrel and AMY1

DIOPT Version :9

Sequence 1:NP_477262.1 Gene:Amyrel / 36863 FlyBaseID:FBgn0020506 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_567714.1 Gene:AMY1 / 828603 AraportID:AT4G25000 Length:423 Species:Arabidopsis thaliana


Alignment Length:353 Identity:77/353 - (21%)
Similarity:132/353 - (37%) Gaps:96/353 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FALTLTLCLAGSLSLAQHNPHWWGNRNTIVHLFEWKWSDIAQECESFLGPRGFAGVQVSPVNENI 68
            |.:..|...:.:|.....|...|.......:.......|||.        .|...:.:.|.::::
plant    15 FIVFPTFTFSSTLLFQSFNWESWKKEGGFYNSLHNSIDDIAN--------AGITHLWLPPPSQSV 71

  Fly    69 LSAGRPWWERYQPIS-YKL-TTRSGNEEEFGDMVRRCNDVGVRIYVDVLLNHMSGD--------- 122
            ...|      |.|.. |.| :::.|:|.|...:::..|..|::...|:::||.:.:         
plant    72 APEG------YLPGKLYDLNSSKYGSEAELKSLIKALNQKGIKALADIVINHRTAERKDDKCGYC 130

  Fly   123 -FDGVAVGTAG--TEAEPS-----KKSFPGVPY--TAQDFHPTCEITDWNDRFQVQQCELVGLKD 177
             |:|   ||:.  .:.:||     ...|||...  |..||....:|...|.|.|         |:
plant   131 YFEG---GTSDDRLDWDPSFVCRNDPKFPGTGNLDTGGDFDGAPDIDHLNPRVQ---------KE 183

  Fly   178 LDQSSDWVRSKLIEFLDHLIELGVAGFRVDAAKHMASEDLEYIYSSLSNLNIDHGFPHNSRPFIF 242
            |.:..:|:::          |:|..|:|.|..:..|        ||::.|.:.:..|    .|..
plant   184 LSEWMNWLKT----------EIGFHGWRFDYVRGYA--------SSITKLYVQNTSP----DFAV 226

  Fly   243 QEVID------HGHETVSRDEYKD----------LGAVTEFRFSEE--IGNAFRGNNALKW--LQ 287
            .|..|      .|.....::|::.          .|.:|.|.|:.:  :.:|.:|.   .|  ..
plant   227 GEKWDDMKYGGDGKLDYDQNEHRSGLKQWIEEAGGGVLTAFDFTTKGILQSAVKGE---LWRLKD 288

  Fly   288 SWGTD---WGFLPSGQALTFVDNHDNQR 312
            |.|..   .|.:| |.|:||:||||..|
plant   289 SQGKPPGMIGIMP-GNAVTFIDNHDTFR 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmyrelNP_477262.1 AmyAc_bac_euk_AmyA 29..398 CDD:200456 72/328 (22%)
Aamy_C 404..492 CDD:214749
AMY1NP_567714.1 PLN00196 5..422 CDD:165762 77/353 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 43 1.000 Domainoid score I4741
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I2673
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D665362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.