DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amyrel and slc3a1

DIOPT Version :9

Sequence 1:NP_477262.1 Gene:Amyrel / 36863 FlyBaseID:FBgn0020506 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_021336428.1 Gene:slc3a1 / 557757 ZFINID:ZDB-GENE-090313-225 Length:674 Species:Danio rerio


Alignment Length:575 Identity:112/575 - (19%)
Similarity:189/575 - (32%) Gaps:186/575 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFALTLTLCL----AGSLSLAQHNPHWWGNRNTIVHLFEWKWSDIAQECESFLGPRGFAGVQV 61
            :|...:..||.|    |..::|:.....|| ..:.|..::...:.|...:     |.....|::.
Zfish    79 IFWLVIACTLALIAMTAAIVALSPRCMSWW-QLSPIYQVYPRSFKDSNAD-----GVGDLRGIKE 137

  Fly    62 SPVNENILSAGRPWWERYQPISYKLTTRS---------------GNEEEFGDMVRRCNDVGVRIY 111
            ...:...|:....|...:    ||...|.               |..|:|.|::...:|.|:::.
Zfish   138 KLSHFEYLNIKAIWISPF----YKSPMRDFGYDVEDFRDVDPLFGTMEDFDDLLTSMHDKGLKLI 198

  Fly   112 VDVLLNHMSGDFDGVAVGTAGTEAEPSKKSFPGVPYT--------AQDFHPTCEITDW-----ND 163
            :|.:.||.|.......:....||           |||        ..|.||    .:|     |.
Zfish   199 MDYIPNHTSDKHVWFQLSRNYTE-----------PYTDYYIWVNCTADKHP----NNWVSVFGNS 248

  Fly   164 RFQV----QQCE----LVGLKDLDQSSDWVRSKLIEFLDHLIELGVAGFRVDAAKHM-------- 212
            .::.    |||.    |....||:..:..|..::.:.:...::.||.|||:||.|||        
Zfish   249 TWEYDEIRQQCYFHQFLKEQPDLNYRNPLVLQEMTDIIHFWLKKGVDGFRMDAVKHMLEATHLRD 313

  Fly   213 ----------ASEDLEYIYSSLSNLNIDHGFPHNSRPFIFQEVIDHGH---ETVSRDEYKDLGAV 264
                      ::.|.|:        .:.|.:.:....  ..|::....   :|.||:..:....|
Zfish   314 EPQVNPDQDPSTVDTEF--------ELYHDYTYTQAG--LHEILTDWRIQMDTYSREPGRYRFMV 368

  Fly   265 TEFRFSEEIGNAFR--------------------------GNNALKWLQSWGTDWGFLPSGQALT 303
            .|....|||....|                          ||.|...::.|.::   :|.|:...
Zfish   369 MESYDYEEIDKTMRYYGTNYAKESDFPFNFYLLDLPDNLSGNYAKSIVERWMSN---MPKGKWPN 430

  Fly   304 F-VDNHDNQRDAGAVLNYKSPRQYKMA------------TAFHLAYPYGISRVMSSFAFD---DH 352
            : |.|||..|     :...:.::|..|            |.:: ....|:..|..|...|   .:
Zfish   431 WVVGNHDKPR-----IGSSAGKEYVRALNMLLLTLPGTPTTYY-GEEIGMVDVNISVIQDPAGQY 489

  Fly   353 DTPPPQDAQERII--SPEFDAD-GACVNGWICEHRWRQI---YAMVGFKNAVRDTEIT------- 404
            |....:|.|...:  :.|.:|. ...:||     .|..|   |..|..:....||..|       
Zfish   490 DPSKSRDPQRTPMQWNNELNAGFSESLNG-----TWLDIASDYRTVNVEVQQDDTSSTISQYRAL 549

  Fly   405 ------------GW----WDNGDNQISFCRG----NKGFLAINNNLYDLSQDLNT 439
                        ||    | |..|..::.|.    :||||.:.|...:.:.||::
Zfish   550 SLLRSSNVILSRGWFCYVW-NDVNVFAYLRELDGLSKGFLVVLNFGKETTTDLSS 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmyrelNP_477262.1 AmyAc_bac_euk_AmyA 29..398 CDD:200456 88/473 (19%)
Aamy_C 404..492 CDD:214749 14/63 (22%)
slc3a1XP_021336428.1 SLC3A2_N 55..113 CDD:318284 8/34 (24%)
AmyAc_SLC3A1 106..563 CDD:200494 93/505 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.