DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amyrel and CD98hc

DIOPT Version :9

Sequence 1:NP_477262.1 Gene:Amyrel / 36863 FlyBaseID:FBgn0020506 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001262354.2 Gene:CD98hc / 40941 FlyBaseID:FBgn0037533 Length:629 Species:Drosophila melanogaster


Alignment Length:511 Identity:103/511 - (20%)
Similarity:166/511 - (32%) Gaps:179/511 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LCLAGSLSLAQHNPHWWGNRNTIVHLFEWKWSDIAQECESFLGPRG-FAGVQVS-----PVNENI 68
            |.:.|:...|...|..|..|                      ||.. ||.|:..     .|.:.:
  Fly   165 LIIIGAPKCAAPQPLPWYKR----------------------GPHAKFASVETCRPEDVQVAKKL 207

  Fly    69 LSAGRPWWERYQPISYKLTTRSGNEEEFGDMVRRCNDVGVRIYVDVLLNHMSGDF----DGVA-- 127
            :||| ..:|....::|.: .:...||:...:|........|:.:|:..|:.:.:.    |.:|  
  Fly   208 VSAG-AIYELPAALTYDV-KKPEVEEKIKHLVALYQGSDTRVILDLTPNYAAKNSQLVQDAIANP 270

  Fly   128 ------VGTAGTEAEPSKKSFPGVPYTAQDFHPTCEITDW---NDRFQVQQCELVGLKDLDQSSD 183
                  |..:|.:|.|:.....|...:|           |   .|.:.:.|.| .|..||..:|.
  Fly   271 EKRSAFVWVSGGKALPNNWLKVGGNRSA-----------WEKVGDNYVLSQFE-DGYYDLKMNST 323

  Fly   184 WVRSKLIEFLDHLIELGVAGFRVDAAKHMA---SEDLEYIYSSLSNLNI---DHGF-PHNSRPF- 240
            .:|::....|.||:.|||.|||:...|..|   |.:.|.|.||..:.::   ::|| .|....| 
  Fly   324 IIRNEFGAVLKHLVALGVRGFRLKNTKFFALFDSLEDEQISSSPKDFSLGPNEYGFYSHRQTTFL 388

  Fly   241 ------------IFQEVIDHGHETVSRDEYK--------DLGAV------------------TEF 267
                        |.:...|....:|:.|..:        |.||.                  .:.
  Fly   389 SGLGDVLYDYLSIVKNASDEAFFSVAEDVMEPQVYQLSGDSGAYGIDLPMYGNFVKVLSKSKPDT 453

  Fly   268 RFSEEIGNAFRGNNALKWLQSWGTDWGFLPSGQALTFVDNHDNQRDAGAVLNYKSPRQYKMATAF 332
            ...:|:.|....:....|||     |..     |..:||               :| |...|.|.
  Fly   454 SLQKELDNTLAQSGTDSWLQ-----WNL-----ADVYVD---------------TP-QDPSALAM 492

  Fly   333 HLAYPYGISRV-MSSFAFDDHDTPPPQDAQERIISPEFDADGACVNGWICEHRWRQIYA------ 390
            .|:...|:..| :.:.|:.:                            :.|..:|||.:      
  Fly   493 FLSLLPGVPVVAVDAVAYQN----------------------------VTEETYRQITSLRKTAS 529

  Fly   391 -MVGFKNAVRDTEITGWWDNGDNQISFCR---GNKGFLAINNNLYDLSQDLNTCLP 442
             |.|..|..:          .|..::|.|   ||.|:..|.|.. :|.|..|..:|
  Fly   530 YMHGNLNLYQ----------ADPLVAFSRIKSGNPGYFVIFNPT-ELPQASNFTIP 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmyrelNP_477262.1 AmyAc_bac_euk_AmyA 29..398 CDD:200456 86/443 (19%)
Aamy_C 404..492 CDD:214749 12/42 (29%)
CD98hcNP_001262354.2 AmyAc_maltase-like 117..593 CDD:200468 103/511 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43447
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.