DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amyrel and Mal-A4

DIOPT Version :9

Sequence 1:NP_477262.1 Gene:Amyrel / 36863 FlyBaseID:FBgn0020506 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_610381.1 Gene:Mal-A4 / 35827 FlyBaseID:FBgn0033294 Length:579 Species:Drosophila melanogaster


Alignment Length:369 Identity:79/369 - (21%)
Similarity:127/369 - (34%) Gaps:147/369 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LSAGRPWWER---YQ--PISYK------------LTTR--------------------------- 89
            :.|..|||:.   ||  |.|:|            :|.:                           
  Fly    18 VDAAAPWWKTASFYQIYPRSFKDSDGNGVGDLNGVTEKLEYLKEIGVTATWLSPFLKSPMADFGY 82

  Fly    90 -----------SGNEEEFGDMVRRCNDVGVRIYVDVLLNHMSGDFDGVAVGTAGTEAEPSKKSF- 142
                       .|..|:|.:||.|..::||:|.:|.:.||.|.:.|......||   |...|.: 
  Fly    83 DISDFKAVDPLFGTMEDFENMVSRAKELGVKIILDFVPNHSSDECDWFLRSAAG---EEEYKDYY 144

  Fly   143 ---PGVPYTAQD---FHPTCEIT-------DWND--------RFQVQQCELVGLKDLDQSSDWVR 186
               ||  :..:|   ..||..::       :|::        :|..:|      .|.:..:..||
  Fly   145 MWHPG--FLDEDGTRRPPTNWVSVFRGSAWEWHEGRQEYYLHQFHKKQ------PDFNFRNPVVR 201

  Fly   187 SKLIEFLDHLIELGVAGFRVDAAKHM----ASEDLEY---IYSSLSNLNIDHGFPHN-------S 237
            .::...|...:|.||.||||||..|.    |.|:..|   ..:..:|...::|:.|.       .
  Fly   202 EEMNNVLRFWLEKGVDGFRVDAIYHAFEIEADENGNYPDEPRNDWTNDPDEYGYTHKIYTVDQPE 266

  Fly   238 RPFI----------FQ------------------EVIDH--GHETVSRDEYKDLGAVTEFRFSEE 272
            .|.:          ||                  |::.|  |:||..       ||...|.| :.
  Fly   267 TPHLVYEWRQILEQFQADNGGDERILMVETWSPIEIVMHYYGNETAD-------GAQIPFNF-QL 323

  Fly   273 IGNAFRGNNALKW---LQSWGTDWGFLPSGQALTFV-DNHDNQR 312
            |.|....::|..:   :.:|   ...:|.|::..:| .|||..|
  Fly   324 ISNLHYDSDAYHYEYLINNW---LNLMPEGKSANWVIGNHDKNR 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmyrelNP_477262.1 AmyAc_bac_euk_AmyA 29..398 CDD:200456 79/369 (21%)
Aamy_C 404..492 CDD:214749
Mal-A4NP_610381.1 AmyAc_maltase 24..492 CDD:200467 77/363 (21%)
Alpha-amylase 47..401 CDD:278554 70/340 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443615
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.