DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amyrel and Mal-B2

DIOPT Version :9

Sequence 1:NP_477262.1 Gene:Amyrel / 36863 FlyBaseID:FBgn0020506 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001188791.2 Gene:Mal-B2 / 34598 FlyBaseID:FBgn0032382 Length:583 Species:Drosophila melanogaster


Alignment Length:467 Identity:89/467 - (19%)
Similarity:163/467 - (34%) Gaps:147/467 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 FLGPRGFAGVQVSPVNEN-ILSAGRPWWERYQPISYK-LTTRSGNEEEFGDMVRRCNDVGVRIYV 112
            :|...|.....:||:.:: ::..|      |....|| :....|..::|.:::....::|:::.:
  Fly    68 YLADTGITATWLSPIFQSPMIDFG------YDISDYKAIQPEYGTMQDFEELIDTAFELGIKVVL 126

  Fly   113 DVLLNHMSG----------------DF----DGVAVGTAGTEAEPSKKSFPGVPY-TAQDFHPTC 156
            |.:.||.|.                ||    ||: |...||...|:  ::|.|.| :|.::|...
  Fly   127 DFVPNHSSDQHEWFKKSAAREPGYEDFYVWHDGI-VQENGTRVPPN--NWPSVFYGSAWEWHEGR 188

  Fly   157 EITDWNDRFQVQQCELVGLKDLDQSSDWVRSKLIEFLDHL----IELGVAGFRVDAAKHM----- 212
            | ..:..:|..:|.:|          ::...|:::.:|.:    :..||||||:||..|:     
  Fly   189 E-QYYLHQFTKEQPDL----------NYRNPKVVQAMDDVLLFWLNKGVAGFRIDAVNHLFEDES 242

  Fly   213 ---------ASEDLEYIYSS----------------LSNLNIDHGFPHNSRPFIFQEVIDHGHET 252
                     .::.|.|.|:.                ...|..|....|..||........:...|
  Fly   243 LKDEPLSGKTTDSLSYDYTKHIYSRDLPEVLEMIHHWRQLLDDFSAKHPERPTRIMMTEAYAGLT 307

  Fly   253 VSRDEYKDLGAVT------EFRFSEEIGNAFRGN--------NALKWLQSWGTDWGFLPSGQALT 303
            ...|.|:|...|.      .|.|..::    :|:        |..|||.       ::|.|.|..
  Fly   308 QLADYYEDSNGVRGSHLPFNFHFITDV----KGDSDARDYVYNVEKWLI-------YMPRGHAAN 361

  Fly   304 FV-DNHDNQRDAGAVLNYKSPRQYKMATAFHLAYPYGISRVMS----------SFAFDDHDTPPP 357
            :| .||||.|    |.:...|..........|..| |::...:          ..::::...||.
  Fly   362 WVMGNHDNPR----VASRFGPASVDAMNMLLLTLP-GVAVTYNGEELGMVDYRELSWEETVDPPA 421

  Fly   358 QDAQERIISPEFDADGACVNGWICEHRWRQIYAMVGFKNAVRDTEITGWWDNGDNQISFCRGNKG 422
            ::..|::                             ::...||...|.:..|.:....|....|.
  Fly   422 RNVGEKL-----------------------------YQEVSRDPVRTPFQWNNETNAGFSTAAKT 457

  Fly   423 FLAINNNLYDLS 434
            :|.::.|..:|:
  Fly   458 WLPVHPNYLELN 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmyrelNP_477262.1 AmyAc_bac_euk_AmyA 29..398 CDD:200456 80/429 (19%)
Aamy_C 404..492 CDD:214749 7/31 (23%)
Mal-B2NP_001188791.2 AmyAc_maltase 33..502 CDD:200467 89/467 (19%)
Malt_amylase_C 510..>541 CDD:351862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443620
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.