DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amyrel and Slc3a1

DIOPT Version :9

Sequence 1:NP_477262.1 Gene:Amyrel / 36863 FlyBaseID:FBgn0020506 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_058912.1 Gene:Slc3a1 / 29484 RGDID:3709 Length:683 Species:Rattus norvegicus


Alignment Length:430 Identity:82/430 - (19%)
Similarity:137/430 - (31%) Gaps:148/430 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GNEEEFGDMVRRCNDVGVRIYVDVLLNH-------------MSGDFDGVAVGTAGTEAEPSKKSF 142
            |..::|.::|...:|.|:::.:|.:.||             .||.:....:....|.|.      
  Rat   185 GTMKDFENLVAAVHDKGLKLIIDFIPNHTSDKHPWFQSSRTRSGKYTDYYIWHNCTHAN------ 243

  Fly   143 PGVPYTAQDFHPTCEITDWNDRFQVQQCE----LVGLKDLDQSSDWVRSKLIEFLDHLIELGVAG 203
             ||.....::......:.|....:.:||.    |....||:..:..|:.::.|.:...:..||.|
  Rat   244 -GVTTPPNNWLSVYGNSSWQFDEERKQCYFHQFLKEQPDLNFRNPAVQEEIKEIIKFWLSKGVDG 307

  Fly   204 FRVDAAKH-MASEDLEYIYSSLSNLNIDHGFPHNSRPFIFQEVIDHGHETVSRDEYKDLGAVTEF 267
            |..||.|. :.::||.                        .|:      .|:..:..|    |..
  Rat   308 FSFDAVKFLLEAKDLR------------------------NEI------QVNTSQIPD----TVT 338

  Fly   268 RFSEEIGNAFRGNNALKWLQSWGTDWGFLPSGQALTFVDNHDNQRDAGAVLNY--KSPRQYKM-- 328
            |:||                        |......|.|..||..||....:|.  :.|.:|:.  
  Rat   339 RYSE------------------------LYHDFTTTQVGMHDLVRDFRQTMNQFSREPGRYRFMG 379

  Fly   329 ------ATAFHLAYPYGISRVM-SSFAFDDH----DTPPPQDAQERIIS-----PEFDADGACVN 377
                  :|...:.| ||:|.:. :.|.|:.:    ||.......|.|.|     ||    |...|
  Rat   380 TEVSAESTERTMVY-YGLSFIQEADFPFNKYLATLDTLSGHTVYEAITSWMENMPE----GKWPN 439

  Fly   378 GWICEHRWRQIYAMVG--FKNAVR---------------------DTEITG-------------- 405
            ..|......::.:.||  :.||:.                     |..||.              
  Rat   440 WMIGGPETSRLTSRVGSEYVNAMNMLLFTLPGTPITYYGEEIGMGDISITNLNERYDTNALLSKS 504

  Fly   406 --WWDNGDNQISFCRGNKGFLAINNNLYDLSQDLNTCLPA 443
              .|||..| ..|...|..:|..|::.:.::.|:....|:
  Rat   505 PMQWDNSSN-AGFTEANHTWLPTNSDYHTVNVDVQKTQPS 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmyrelNP_477262.1 AmyAc_bac_euk_AmyA 29..398 CDD:200456 68/346 (20%)
Aamy_C 404..492 CDD:214749 11/56 (20%)
Slc3a1NP_058912.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
AmyAc_SLC3A1 113..566 CDD:200494 82/430 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.