DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amyrel and mal1

DIOPT Version :9

Sequence 1:NP_477262.1 Gene:Amyrel / 36863 FlyBaseID:FBgn0020506 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_595063.1 Gene:mal1 / 2539976 PomBaseID:SPBC1683.07 Length:579 Species:Schizosaccharomyces pombe


Alignment Length:413 Identity:81/413 - (19%)
Similarity:151/413 - (36%) Gaps:109/413 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PHWWGNRNTIVH-LFEWKWSDIAQECESFLGPRGFAGVQ--VSPVNE-NILSAGRPWW------- 76
            |:||  |.|.|: ::...:.|...:        ||..::  :|.|:. ..|:....|.       
pombe    11 PNWW--RETSVYQIYPASFKDSNGD--------GFGDLEGIISKVDYLKALNVESIWLCPIYPSP 65

  Fly    77 ---ERYQPISYK-LTTRSGNEEEFGDMVRRCNDVGVRIYVDVLLNHMSGDFDGVAVGTAGTEAEP 137
               ..|....|| :.:|.|..|:...:::..::..:::.:|::|||.|...:... .:..::..|
pombe    66 LKDMGYDVSDYKQIDSRYGTLEDLDRLMKALHERDMKLVMDLVLNHTSDQHEWFK-ESRSSKTNP 129

  Fly   138 SKKSFPGVPYTAQDFHPTCEITDWNDRFQVQQCE-------------LVGLKDLDQSSDWVRSKL 189
            .:..:...|....:........:|...|.....|             .||..||:..:..||..:
pombe   130 KRDWYFWKPARYNEKGERLPPNNWRSYFDTSAWEWDEATQEYYLHLWSVGQPDLNWETPKVREAV 194

  Fly   190 IEFLDHLIELGVAGFRVDAAKHMASED----------------LEYIY-----------SSLSNL 227
            .:.|...::.||.|||:||. :|.|:|                |.|.|           :.:.|:
pombe   195 HDILRFWLDRGVDGFRLDAI-NMISKDQRFLDAPITDDRYEYQLAYQYYANGPRIHEYLNGIGNI 258

  Fly   228 NIDH-GFPHNSRPFIF--QEVIDHGHETVSRDEYKDLGAVTEFRF---------SEEIGNAFRGN 280
            ..:: .|.....|::.  .|::    ..|..|. ::|..:.:|.|         .:.|..::..:
pombe   259 LTEYDAFSVGEMPYVLDTNEIL----HVVGADR-RELTMIFQFDFVDLDLDPNQHKYIEGSWELS 318

  Fly   281 NALKWLQSW------GTDWGFLPSGQALTFVDNHDNQRDAGAVLNYKSPRQYKMATAFHLAYPYG 339
            :..|.|:.|      |..|.       .:|::|||..|.....|: .||:        :.||.  
pombe   319 DLKKSLKKWQSALLSGGGWN-------ASFIENHDQTRTVSRYLS-DSPK--------YRAYS-- 365

  Fly   340 ISRVMSSFAFDDHDTPPPQDAQE 362
             |::|:.|......||.....||
pombe   366 -SKLMALFIIFQSGTPFVFQGQE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmyrelNP_477262.1 AmyAc_bac_euk_AmyA 29..398 CDD:200456 78/407 (19%)
Aamy_C 404..492 CDD:214749
mal1NP_595063.1 trehalose_treC 13..579 CDD:274115 80/411 (19%)
AmyAc_SI_OligoGlu_DGase 15..496 CDD:200472 78/407 (19%)
Malt_amylase_C 504..576 CDD:295440
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.