DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amyrel and SPCC11E10.09c

DIOPT Version :9

Sequence 1:NP_477262.1 Gene:Amyrel / 36863 FlyBaseID:FBgn0020506 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001342914.1 Gene:SPCC11E10.09c / 2539049 PomBaseID:SPCC11E10.09c Length:478 Species:Schizosaccharomyces pombe


Alignment Length:308 Identity:64/308 - (20%)
Similarity:113/308 - (36%) Gaps:64/308 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 WSDIAQECESFLGPRGFAGVQVSPVNENI---LSAGRPWWERYQPISYKLTTRSGNEEEFGDMVR 101
            |..|.:..: ::...|...:.:||:.:||   ...|:.:...:.....:|....|.||:..::|.
pombe    53 WKGITRNLD-YIKSLGCTAIWISPIVKNISETTDCGQAYHGYWAQDMTQLNENFGTEEDLKELVN 116

  Fly   102 RCNDVGVRIYVDVLLNHMSGDFDGVAVGTAGTEA------EP--SKKSFPGVPYTAQDFHPTCEI 158
            ..::..:...||:::|||         |.||::.      :|  |.|.:....:......|...|
pombe   117 AIHEKNMLCMVDIVVNHM---------GHAGSKPVNFLLYQPFNSGKYYHNWQFVQNYDDPHETI 172

  Fly   159 TDW-NDRFQVQQCELVGLKDLDQSSDWVRSKLIEFLDHLIE-LGVAGFRVDAAKHMASEDLEYIY 221
            |.| .|..       |.|.|:....:.||.....::..||: ....|.|:|.|||:   :..:..
pombe   173 TGWLGDSH-------VNLPDIRTEKNEVRKFFQNWVSDLIKRYQFDGIRLDTAKHV---EKSFFP 227

  Fly   222 SSLSNLNIDHGFPHNSRPFIFQEVIDHGHETVSRDEYKDLGAVTEFRFSEEIGNAFRG------- 279
            :.:...|:          |...||. ||...|..|..|.|.:...|....::...|..       
pombe   228 TFIEAANV----------FTTGEVF-HGDPKVVGDYQKYLPSTLNFPLFFQLRETFLDPKHSMFS 281

  Fly   280 --NNALKWLQSWGTDWGFLPSGQALTFVDNHD------NQRDAGAVLN 319
              :.|:..::.:..|...|     ..|::|||      ..:|....||
pombe   282 FYDKAVLDVRHYFKDVTVL-----CNFLENHDFPRFFHETKDIALALN 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmyrelNP_477262.1 AmyAc_bac_euk_AmyA 29..398 CDD:200456 64/308 (21%)
Aamy_C 404..492 CDD:214749
SPCC11E10.09cNP_001342914.1 AmyAc_euk_AmyA 19..384 CDD:200458 64/308 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X338
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.