DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gprs and ENC1

DIOPT Version :10

Sequence 1:NP_725599.2 Gene:gprs / 36862 FlyBaseID:FBgn0024232 Length:1302 Species:Drosophila melanogaster
Sequence 2:NP_003624.1 Gene:ENC1 / 8507 HGNCID:3345 Length:589 Species:Homo sapiens


Alignment Length:272 Identity:61/272 - (22%)
Similarity:102/272 - (37%) Gaps:73/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DVTFLVGDTREPVCAVKAVLASRSRVFAKMLYAAPSPQRKRETSTKENKLRLFLKRSSEPLLNLQ 105
            ||....|:...| |. :||||:.||.|..|....                   ||.|.:..:|..
Human    47 DVLLHAGNRTFP-CH-RAVLAACSRYFEAMFSGG-------------------LKESQDSEVNFD 90

  Fly   106 NAAQQRTGYTQQLAPIPEPSGQQHQTLIIEEFEPDVFRQLIEYIHTGCVTLQPRTLLGVMNAADY 170
            |:                             ..|:|...|::|.::..|.:.......::.|.|.
Human    91 NS-----------------------------IHPEVLELLLDYAYSSRVIINEENAESLLEAGDM 126

  Fly   171 YGLEELRRACAGFVQCCINVDTVCALLASAERYIQYKCTKTLVQKVLEFVDEHGTEVLNLGSFTL 235
            ...:::|.|||.|::..::......:|..::   .::||| |.:........:...:.....|..
Human   127 LEFQDIRDACAEFLEKNLHPTNCLGMLLLSD---AHQCTK-LYELSWRMCLSNFQTIRKNEDFLQ 187

  Fly   236 LPQHVVRLILAREELRA-DEFTKFQAALMW----SKKYYDNNPNIDIKEILGTFCEYIQFHKIPA 295
            |||.:|..:|:.|||.. ||...:::|:.|    .||.|...|     |:|.|    ::...:||
Human   188 LPQDMVVQLLSSEELETEDERLVYESAINWISYDLKKRYCYLP-----ELLQT----VRLALLPA 243

  Fly   296 -----NVLMREI 302
                 ||.|.|:
Human   244 IYLMENVAMEEL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gprsNP_725599.2 BTB_POZ_BTBD19 26..184 CDD:349603 29/142 (20%)
BACK_GPRS_like 189..268 CDD:350582 19/83 (23%)
ENC1NP_003624.1 BTB_POZ_KLHL37_ENC1 6..152 CDD:349576 30/154 (19%)
PHA03098 48..566 CDD:222983 60/271 (22%)
BACK_KLHL37_ENC1 145..242 CDD:350590 25/109 (23%)
Kelch 1 296..340
KELCH repeat 330..374 CDD:276965
Kelch 2 341..388
KELCH repeat 378..431 CDD:276965
Kelch 3 389..444
KELCH repeat 434..480 CDD:276965
Kelch 4 446..492
Kelch 5 494..538
KELCH repeat 528..568 CDD:276965
Kelch 6 539..585
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.