DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gprs and KLHL25

DIOPT Version :10

Sequence 1:NP_725599.2 Gene:gprs / 36862 FlyBaseID:FBgn0024232 Length:1302 Species:Drosophila melanogaster
Sequence 2:XP_054234589.1 Gene:KLHL25 / 64410 HGNCID:25732 Length:619 Species:Homo sapiens


Alignment Length:291 Identity:58/291 - (19%)
Similarity:99/291 - (34%) Gaps:93/291 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DVTFLVGDTREPVCAVKAVLASRSRVFAKMLYAAPSPQRKRETSTKENKLRLFLKRSSEPLLNLQ 105
            |||...||...| |. :||||:.||.|..|....                   |:.|.:..:|.|
Human    77 DVTLWAGDRAFP-CH-RAVLAASSRYFEAMFSHG-------------------LRESRDDTVNFQ 120

  Fly   106 NAAQQRTGYTQQLAPIPEPSGQQHQTLIIEEFEPDVFRQLIEYIHTGCVTLQPRTLLGVMNAADY 170
                                         :...|:|...|:::.::..:.:.......::.|.|.
Human   121 -----------------------------DNLHPEVLELLLDFAYSSRIAINEENAESLLEAGDM 156

  Fly   171 YGLEELRRACAGFVQ------CCINVDTVCALLASA---ERYIQYKCTKTLVQKVLEFVDEHGTE 226
            ....::|.|.|.|::      .|:.:    .||:.|   .|..::.....||         |...
Human   157 LQFHDVRDAAAEFLEKNLFPSNCLGM----MLLSDAHQCRRLYEFSWRMCLV---------HFET 208

  Fly   227 VLNLGSFTLLPQHVVRLILAREELRA-DEFTKFQAALMWSKKYYDNNPNIDIKEILGTFCEYIQF 290
            |.....|..|.:..:..:::.:||.. ||...|:|.|.|.|  :|..|                 
Human   209 VRQSEDFNSLSKDTLLDLISSDELETEDERVVFEAILQWVK--HDLEP----------------- 254

  Fly   291 HKIPANVLMREIHPLNLVPYAIIMNALAYQA 321
            .|:....|:|.:. |.|:|...:..|::.:|
Human   255 RKVHLPELLRSVR-LALLPSDCLQEAVSSEA 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gprsNP_725599.2 BTB_POZ_BTBD19 26..184 CDD:349603 27/142 (19%)
BACK_GPRS_like 189..268 CDD:350582 19/82 (23%)
KLHL25XP_054234589.1 BTB_POZ_KLHL25 54..181 CDD:349563 29/153 (19%)
PHA03098 69..596 CDD:222983 58/291 (20%)
BACK_KLHL25_ENC2 174..272 CDD:350589 27/130 (21%)
KELCH repeat 360..404 CDD:276965
KELCH repeat 408..461 CDD:276965
KELCH repeat 464..510 CDD:276965
KELCH repeat 512..554 CDD:276965
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.