DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gprs and Kbtbd2

DIOPT Version :10

Sequence 1:NP_725599.2 Gene:gprs / 36862 FlyBaseID:FBgn0024232 Length:1302 Species:Drosophila melanogaster
Sequence 2:NP_001101331.1 Gene:Kbtbd2 / 312372 RGDID:1310317 Length:623 Species:Rattus norvegicus


Alignment Length:323 Identity:65/323 - (20%)
Similarity:117/323 - (36%) Gaps:77/323 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EPDLSTFENKTGLAEDMKFLASMPELCDVTFLVGDTREPVCAVKAVLASRSRVFAKMLYAAPSPQ 78
            |..::| |....|.|.:|.........|:..:|..|..| |. |.|||:.|..|..|..:..|..
  Rat     6 ERQINT-EYAVSLLEQLKLFYEQQLFTDIVLIVEGTEFP-CH-KMVLATCSSYFRAMFMSGLSES 67

  Fly    79 RKRETSTKENKLRLFLKRSSEPLLNLQNAAQQRTGYTQQLAPIPEPSGQQHQTLIIEEFEPDVFR 143
                            |::...|.|:..||.|                                 
  Rat    68 ----------------KQTHVHLRNVDAAALQ--------------------------------- 83

  Fly   144 QLIEYIHTGCVTLQPRTLLGVMNAADYYGLEELRRACAGFVQCCINVDTVCALLASAERYIQYKC 208
            .:|.|.:||.:.:...|:..:...|.:..:|::.:.|..::...||.:....||:.|:   .:.|
  Rat    84 MIITYAYTGNLAINDSTVEQLYETACFLQVEDVLQRCREYLIKKINAENCVRLLSFAD---LFSC 145

  Fly   209 TKTLVQKVLEFVDEHGTEVLNLGSFTLLPQHVVRLILAREELRAD-EFTKFQAALMW------SK 266
             :.|.|.....|:...|.|....:|..|...::..||:.:.|..: |.|..:||::|      |:
  Rat   146 -EELKQSAKRMVEHKFTAVYRQEAFMQLSHDLLIDILSSDNLNVEKEETVREAAMLWLEYNTESR 209

  Fly   267 KYYDNNPNIDIK-EILGTFCEYIQFHKIPANVLMREIHPLNLVPYAIIMNALAYQADPESIDP 328
            ..|.::....|: :.|....:...|..:|.|            ..::::..| |::.|:...|
  Rat   210 SQYLSSVLSQIRIDALSEVTQRAWFQGLPPN------------DKSVVVQGL-YKSMPKFFKP 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gprsNP_725599.2 BTB_POZ_BTBD19 26..184 CDD:349603 30/157 (19%)
BACK_GPRS_like 189..268 CDD:350582 21/85 (25%)
Kbtbd2NP_001101331.1 BTB_POZ_KBTBD2_BKLHD1 5..137 CDD:349579 35/182 (19%)
PHA03098 23..516 CDD:222983 59/305 (19%)
BACK_KBTBD2 128..223 CDD:350554 24/98 (24%)
KELCH repeat 310..366 CDD:276965
KELCH repeat 374..415 CDD:276965
KELCH repeat 419..456 CDD:276965
KELCH repeat 459..516 CDD:276965
KELCH repeat 519..568 CDD:276965
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.