DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gprs and Klhl41

DIOPT Version :10

Sequence 1:NP_725599.2 Gene:gprs / 36862 FlyBaseID:FBgn0024232 Length:1302 Species:Drosophila melanogaster
Sequence 2:NP_001074556.1 Gene:Klhl41 / 228003 MGIID:2683854 Length:606 Species:Mus musculus


Alignment Length:250 Identity:38/250 - (15%)
Similarity:87/250 - (34%) Gaps:58/250 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TGLAEDMKFLASMPELCDVTFLVGDTREPVCAVKAVLASRSRVFAKMLYAAPSPQRKRETSTKEN 88
            |.|.:.:|.|....:..|.|...||...| |. :.:|::.|..|.:...:....::|:|.:    
Mouse    17 TLLQDGLKDLLEEKKFIDCTLKAGDKSFP-CH-RLILSACSPYFREYFLSEIEEEKKKEVA---- 75

  Fly    89 KLRLFLKRSSEPLLNLQNAAQQRTGYTQQLAPIPEPSGQQHQTLIIEEFEPDVFRQLIEYIHTGC 153
                                                         ::..:|.:...:|:|:::..
Mouse    76 ---------------------------------------------LDNVDPAILDLIIKYLYSAS 95

  Fly   154 VTLQPRTLLGVMNAADYYGLEELRRACAGFVQCCINVDTVCALLASAERYIQYKCTKTLVQKVLE 218
            :.|....:..:...:..:.:..:...|..::|..:......|:|...   :...|.: |.....|
Mouse    96 IDLNDGNVQDIFALSSRFQIPSVFTVCVSYLQKRLAPGNCLAILRLG---LLLDCPR-LAISARE 156

  Fly   219 FVDEHGTEVLNLGSF-TLLPQHVVRLILAREELRAD-EFTKFQAALMWSKKYYDN 271
            ||.:...::.....| .|.||.::. :::.:.|..: |...|:|.:.|.:...:|
Mouse   157 FVSDRFVQICKEEDFMQLSPQELIS-VISNDSLNVEKEEVVFEAVMKWVRTDKEN 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gprsNP_725599.2 BTB_POZ_BTBD19 26..184 CDD:349603 19/157 (12%)
BACK_GPRS_like 189..268 CDD:350582 16/80 (20%)
Klhl41NP_001074556.1 BTB_POZ_KLHL41_KBTBD10 6..135 CDD:349650 21/168 (13%)
PHA03098 39..578 CDD:222983 31/227 (14%)
KELCH repeat 335..384 CDD:276965
Kelch 1 346..398
KELCH repeat 388..433 CDD:276965
Kelch 2 399..447
KELCH repeat 437..482 CDD:276965
Kelch 3 448..495
KELCH repeat 485..530 CDD:276965
Kelch 4 497..542
Kelch 5 544..599
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.