DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gprs and KLHL40

DIOPT Version :10

Sequence 1:NP_725599.2 Gene:gprs / 36862 FlyBaseID:FBgn0024232 Length:1302 Species:Drosophila melanogaster
Sequence 2:NP_689606.2 Gene:KLHL40 / 131377 HGNCID:30372 Length:621 Species:Homo sapiens


Alignment Length:249 Identity:55/249 - (22%)
Similarity:94/249 - (37%) Gaps:56/249 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PEPSGQQHQTLIIEEFEPDVFRQLIEYIHTGCVTLQPRTLLGVMNAADYYGLEELRRACAGFVQ- 185
            ||.:|:.|    :||..|||..|::.|::|..:.|...::..:..||..:.:..:...|..|:| 
Human    66 PERAGELH----LEEVSPDVVAQVLHYLYTSEIALDEASVQDLFAAAHRFQIPSIFTICVSFLQK 126

  Fly   186 --CCINVDTV--------CALLASAERYIQYKCTKTLVQKVLEFVDEHGTEVLNLGSFTLLPQHV 240
              |..|...|        ||.||.|.|               :|:..|.|.|.....|..|....
Human   127 RLCLSNCLAVFRLGLLLDCARLAVAAR---------------DFICAHFTLVARDADFLGLSADE 176

  Fly   241 VRLILAREELRAD-EFTKFQAALMWSKKYYDNNPNIDIKEILGTFCEYIQFHKIPANVLMREI-- 302
            :..|::.:.|..: |...|:|.:.|:.. .|.....:.:..|.|..|.::...:|...|...:  
Human   177 LIAIISSDGLNVEKEEAVFEAVMRWAGS-GDAEAQAERQRALPTVFESVRCRLLPRAFLESRVER 240

  Fly   303 HPLNLVPYAIIMNALAYQADPESIDPGKLSPNSSRQHHRHRHHHQSLPKIRKAK 356
            |||             .:|.||.:...::..::         |...:..:||.|
Human   241 HPL-------------VRAQPELLRKVQMVKDA---------HEGRITTLRKKK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gprsNP_725599.2 BTB_POZ_BTBD19 26..184 CDD:349603 16/61 (26%)
BACK_GPRS_like 189..268 CDD:350582 20/87 (23%)
KLHL40NP_689606.2 BTB_POZ_KLHL40_KBTBD5 6..137 CDD:349649 20/74 (27%)
PHA03098 47..551 CDD:222983 55/249 (22%)
BACK 128..230 CDD:475122 25/117 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..295 3/8 (38%)
KELCH repeat 351..398 CDD:276965
Kelch 1 360..412
KELCH repeat 402..448 CDD:276965
Kelch 2 413..462
KELCH repeat 452..497 CDD:276965
Kelch 3 463..510
Kelch 4 512..557
Kelch_1 547..594 CDD:396078
KELCH repeat 547..594 CDD:276965
Kelch 5 559..613
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.