DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5065 and LYS2

DIOPT Version :9

Sequence 1:NP_001163168.1 Gene:CG5065 / 36860 FlyBaseID:FBgn0034145 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_009673.1 Gene:LYS2 / 852412 SGDID:S000000319 Length:1392 Species:Saccharomyces cerevisiae


Alignment Length:313 Identity:76/313 - (24%)
Similarity:130/313 - (41%) Gaps:65/313 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 SVFITGGTGFMGKVLVEKLLRSCPEIRN--IYLLIRPKRGQEVSARLTELLNAPLFESLRQEKPK 189
            :||:||.|||:|..::..||...|:..:  ::..:|.|..:...|||.:   |.:......||..
Yeast   972 NVFVTGVTGFLGSYILADLLGRSPKNYSFKVFAHVRAKDEEAAFARLQK---AGITYGTWNEKFA 1033

  Fly   190 ELSKVIPISGDITSEELGISEKDQNLLCRNVSVVFHSAATVKF---DEKLK---LSVTINML--- 245
            ...||  :.||::..:.|:|::....|...|.::.|:.|.|.:   ..||:   :..|||::   
Yeast  1034 SNIKV--VLGDLSKSQFGLSDEKWMDLANTVDIIIHNGALVHWVYPYAKLRDPNVISTINVMSLA 1096

  Fly   246 --GTKRLVELCHRMLSLDALIHVSTAYCNCDRTDVSEVIYAPP--YNPDDIISLINWLPEDILDQ 306
              |..:..:......:||     :..|.|.....|||   ..|  ...||:::..:.|       
Yeast  1097 AVGKPKFFDFVSSTSTLD-----TEYYFNLSDKLVSE---GKPGILESDDLMNSASGL------- 1146

  Fly   307 LTPRLIGKRPNTYTFTKALAEHMLLKEAG--NLPVAIVRPSIVTASLNEPFAGWVDNFNGPTGLV 369
                     ...|..:|..||: :::.||  .|...||||..||.:          :.||.:...
Yeast  1147 ---------TGGYGQSKWAAEY-IIRRAGERGLRGCIVRPGYVTGA----------SANGSSNTD 1191

  Fly   370 SALAKGMFRTMMCEK-----NYVADMVPVDIVINLMIAAAWRTATRKSNNLLI 417
            ..|.:.:..::...|     |.| :|||||.|..:::|.:....  |.|.|.:
Yeast  1192 DFLLRFLKGSVQLGKIPDIENSV-NMVPVDHVARVVVATSLNPP--KENELAV 1241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5065NP_001163168.1 FAR-N_SDR_e 126..445 CDD:187547 76/313 (24%)
Sterile 472..562 CDD:281068
LYS2NP_009673.1 alpha_am_amid 7..1379 CDD:274582 76/313 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I2873
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.712175 Normalized mean entropy S3219
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.