DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8306 and AT3G60060

DIOPT Version :9

Sequence 1:NP_611140.3 Gene:CG8306 / 36857 FlyBaseID:FBgn0034142 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_191565.1 Gene:AT3G60060 / 825176 AraportID:AT3G60060 Length:154 Species:Arabidopsis thaliana


Alignment Length:141 Identity:32/141 - (22%)
Similarity:61/141 - (43%) Gaps:39/141 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FYAGRNVFITGATGFVGVTIVEKLLRDVPNVGTLYLLMRAKKGKSVQERLEELKKNSVFDKFKEL 73
            |.|...:|:|                     |.:.|:::|...::.::||        :.:|.  
plant    16 FLARERLFVT---------------------GKIVLVIKANDQEAAKKRL--------YFQFH-- 49

  Fly    74 QLQSRLSKIVPIEGDVGLEHLGISPKDRQTLIDNVNVVFHSAATLDFFQSLKETTNINLRGTRRV 138
              .|.|||::|:..|:..::||:..:....:.:.::::..||||..|..||     .|..|..|:
plant    50 --PSILSKLLPVVEDIAEDNLGVDSETSLKISEEIDIIISSAATTTFDDSL-----WNFTGPWRI 107

  Fly   139 V-ELCQQIKNL 148
            . :.||:..||
plant   108 YSDACQRGNNL 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8306NP_611140.3 PLN02996 6..456 CDD:215538 32/141 (23%)
FAR-N_SDR_e 13..339 CDD:187547 30/137 (22%)
FAR_C 364..454 CDD:176924
AT3G60060NP_191565.1 NADB_Rossmann 25..>98 CDD:304358 20/105 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3320
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000172
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.