DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8306 and SPCC162.02c

DIOPT Version :9

Sequence 1:NP_611140.3 Gene:CG8306 / 36857 FlyBaseID:FBgn0034142 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_588242.1 Gene:SPCC162.02c / 2538929 PomBaseID:SPCC162.02c Length:981 Species:Schizosaccharomyces pombe


Alignment Length:229 Identity:49/229 - (21%)
Similarity:91/229 - (39%) Gaps:50/229 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GRNVFITGATGFVGVTIVEKLLRDVPNVGTLYLLMRAKKGKSVQERLEELKKNSVFDKFKELQLQ 76
            |:...:|||||:.|...:|.|::  .|:..:.|         |:|..:|..|..:......|::.
pombe   644 GQYFLLTGATGYFGRRFLEYLVK--LNISVVCL---------VRESSDEAAKERLISLVPSLRIS 697

  Fly    77 SRLSKIVPIEGDVGLEHLGISPKDRQTLIDNVNVVFHSAATLDFFQSLKETTNINLRGTRRVVEL 141
            |  ..|:.....|.....|:.....:.|::||:.::|.||.:.:.:|.:|....|:.||:.|:||
pombe   698 S--ENIIVWAAHVEEIRFGLDDAKWEFLVENVSRIYHMAAEVHWMKSYQELRPANVLGTKTVLEL 760

  Fly   142 CQQIKNLDALVHVSSAYVNAYLTKVEEKLYPAPEDPEKIIQLSETLNDDALKELEPKLLKDHPNT 206
              .:....||..:|...                       |....|:||....        ..:.
pombe   761 --SVMGPKALYFISGGG-----------------------QQEVELDDDTQSA--------KASG 792

  Fly   207 YTFTKHLAE---HEVANVASKFPCGIVRPSMITA 237
            |..:|::||   .:::::.... ..::||..|.|
pombe   793 YALSKYVAELLCRKISDLGHPL-IYVIRPGFIIA 825

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8306NP_611140.3 PLN02996 6..456 CDD:215538 49/229 (21%)
FAR-N_SDR_e 13..339 CDD:187547 48/228 (21%)
FAR_C 364..454 CDD:176924
SPCC162.02cNP_588242.1 CaiC 16..514 CDD:223395
AFD_class_I 44..518 CDD:302604
SDR_e1 646..912 CDD:187546 48/227 (21%)
Lys2b 647..981 CDD:225857 48/226 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I3369
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000172
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.