DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP2 and RPP2A

DIOPT Version :9

Sequence 1:NP_523764.1 Gene:RpLP2 / 36855 FlyBaseID:FBgn0003274 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_014603.1 Gene:RPP2A / 854118 SGDID:S000005399 Length:106 Species:Saccharomyces cerevisiae


Alignment Length:114 Identity:54/114 - (47%)
Similarity:77/114 - (67%) Gaps:9/114 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKLSSM 65
            |:|:|||||....| ::|..:.::.||.|||:|::.|:::.|:..|.|||:|:||.||.|||:::
Yeast     1 MKYLAAYLLLNAAG-NTPDATKIKAILESVGIEIEDEKVSSVLSALEGKSVDELITEGNEKLAAV 64

  Fly    66 PVGGGGAVAAADAAPAAAAGGDKKEAKKEEKKEE-SESEDDDMGFALFE 113
            |..|     .|.|..||||.||  .|.:|||:|| :|..||||||.||:
Yeast    65 PAAG-----PASAGGAAAASGD--AAAEEEKEEEAAEESDDDMGFGLFD 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP2NP_523764.1 Ribosomal_P2 1..>65 CDD:100111 29/63 (46%)
RPP2ANP_014603.1 Ribosomal_P2 15..106 CDD:100111 45/97 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345798
Domainoid 1 1.000 82 1.000 Domainoid score I1955
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I1436
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53848
OrthoFinder 1 1.000 - - FOG0000927
OrthoInspector 1 1.000 - - otm46889
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21141
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1147
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.030

Return to query results.
Submit another query.