DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP2 and RPP2B

DIOPT Version :9

Sequence 1:NP_523764.1 Gene:RpLP2 / 36855 FlyBaseID:FBgn0003274 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_010670.3 Gene:RPP2B / 851990 SGDID:S000002790 Length:110 Species:Saccharomyces cerevisiae


Alignment Length:114 Identity:55/114 - (48%)
Similarity:81/114 - (71%) Gaps:5/114 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGK-SIDDLIKEGREKLSS 64
            |:|:|||||.|.||..:|:.:|::.::.|||.|||..|:.:::..|.|| |::::|.||::|.::
Yeast     1 MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKGSLEEIIAEGQKKFAT 65

  Fly    65 MPVGGGGAVAAADAAPAAAAGGDKKEAKKEEKKEESESEDDDMGFALFE 113
            :|.||..: |||.||.|||.|...:|.|:||.||||   ||||||.||:
Yeast    66 VPTGGASS-AAAGAAGAAAGGDAAEEEKEEEAKEES---DDDMGFGLFD 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP2NP_523764.1 Ribosomal_P2 1..>65 CDD:100111 27/64 (42%)
RPP2BNP_010670.3 Ribosomal_P2 1..110 CDD:100111 54/112 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345797
Domainoid 1 1.000 82 1.000 Domainoid score I1955
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I1436
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53848
OrthoFinder 1 1.000 - - FOG0000927
OrthoInspector 1 1.000 - - otm46889
orthoMCL 1 0.900 - - OOG6_100883
Panther 1 1.100 - - LDO PTHR21141
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1147
SonicParanoid 1 1.000 - - X755
TreeFam 00.000 Not matched by this tool.
1211.930

Return to query results.
Submit another query.