DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP2 and AT5G40040

DIOPT Version :9

Sequence 1:NP_523764.1 Gene:RpLP2 / 36855 FlyBaseID:FBgn0003274 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_198820.1 Gene:AT5G40040 / 834001 AraportID:AT5G40040 Length:114 Species:Arabidopsis thaliana


Alignment Length:118 Identity:52/118 - (44%)
Similarity:75/118 - (63%) Gaps:9/118 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKLSSM 65
            |:.|||||||.|.|.::|:.:||:||:.|||.|:|.|::......:..:.:.:||..||||::::
plant     1 MKVVAAYLLAKLSGNENPSVADLKKIVESVGAEIDQEKIDLFFSLIKDRDVTELIAVGREKMAAL 65

  Fly    66 PVGGGGAVAAAD-----AAPAAAAGGDKKEAKKEEKKEESESEDDDMGFALFE 113
            . .||||||.|.     |||||.....:.: ||||:||  |||||....:||:
plant    66 S-SGGGAVAVASGGGGGAAPAAEPASVESK-KKEEEKE--ESEDDGGMMSLFD 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP2NP_523764.1 Ribosomal_P2 1..>65 CDD:100111 27/63 (43%)
AT5G40040NP_198820.1 Ribosomal_P2 1..>65 CDD:100111 27/63 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53848
OrthoDB 1 1.010 - - D1626327at2759
OrthoFinder 1 1.000 - - FOG0000927
OrthoInspector 1 1.000 - - otm2620
orthoMCL 1 0.900 - - OOG6_100883
Panther 1 1.100 - - O PTHR21141
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X755
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.