DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP2 and AT3G44590

DIOPT Version :9

Sequence 1:NP_523764.1 Gene:RpLP2 / 36855 FlyBaseID:FBgn0003274 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_190045.1 Gene:AT3G44590 / 823584 AraportID:AT3G44590 Length:111 Species:Arabidopsis thaliana


Alignment Length:115 Identity:60/115 - (52%)
Similarity:84/115 - (73%) Gaps:6/115 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKLSSM 65
            |:..||:|||||||..:|:..:::.|:.:||.:||.|.:..::||::||.|.:||..|||||:|:
plant     1 MKVAAAFLLAVLGGNANPSADNIKDIIGAVGADVDGESIELLLKEVSGKDIAELIASGREKLASV 65

  Fly    66 PVGGGGAVAAADAA--PAAAAGGDKKEAKKEEKKEESESEDDDMGFALFE 113
            |.|||.||:||.::  ..|||..:|||||||||:|    .||||||:|||
plant    66 PSGGGVAVSAAPSSGGGGAAAPAEKKEAKKEEKEE----SDDDMGFSLFE 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP2NP_523764.1 Ribosomal_P2 1..>65 CDD:100111 29/63 (46%)
AT3G44590NP_190045.1 Ribosomal_P1_P2_L12p 1..111 CDD:304398 58/113 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2621
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I1952
OMA 1 1.010 - - QHG53848
OrthoDB 1 1.010 - - D1626327at2759
OrthoFinder 1 1.000 - - FOG0000927
OrthoInspector 1 1.000 - - otm2620
orthoMCL 1 0.900 - - OOG6_100883
Panther 1 1.100 - - O PTHR21141
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X755
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.