DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP2 and AT3G28500

DIOPT Version :9

Sequence 1:NP_523764.1 Gene:RpLP2 / 36855 FlyBaseID:FBgn0003274 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_189491.1 Gene:AT3G28500 / 822480 AraportID:AT3G28500 Length:115 Species:Arabidopsis thaliana


Alignment Length:122 Identity:46/122 - (37%)
Similarity:70/122 - (57%) Gaps:16/122 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKLS-- 63
            |:.:||:|||.|||.::|.::||:|||.|||.|:|..::..:...:....:.:||..||||:|  
plant     1 MKVIAAFLLAKLGGNENPTSNDLKKILESVGAEIDETKIDLLFSLIKDHDVTELIAAGREKMSAL 65

  Fly    64 -------SMPVGGGGAVAAADAAPAAAAGGDKKEAKKEEKKEESESEDDDMGFALFE 113
                   :|..||||..||:.|.|.|       |:||:.::.:.||.||.....||:
plant    66 SSGGPAVAMVAGGGGGGAASAAEPVA-------ESKKKVEEVKDESSDDAGMMGLFD 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP2NP_523764.1 Ribosomal_P2 1..>65 CDD:100111 27/72 (38%)
AT3G28500NP_189491.1 Ribosomal_P2 1..115 CDD:100111 45/120 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53848
OrthoDB 1 1.010 - - D1626327at2759
OrthoFinder 1 1.000 - - FOG0000927
OrthoInspector 1 1.000 - - otm2620
orthoMCL 1 0.900 - - OOG6_100883
Panther 1 1.100 - - O PTHR21141
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.