DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP2 and AT2G27720

DIOPT Version :9

Sequence 1:NP_523764.1 Gene:RpLP2 / 36855 FlyBaseID:FBgn0003274 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001154535.1 Gene:AT2G27720 / 817318 AraportID:AT2G27720 Length:130 Species:Arabidopsis thaliana


Alignment Length:130 Identity:61/130 - (46%)
Similarity:77/130 - (59%) Gaps:17/130 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRYVAAYLLAVLGGKDSPANSDLEKILSS---------------VGVEVDAERLTKVIKELAGKS 50
            |:.|||:|||||.||.||...|::.||.|               .|.|.:..::..::||:.||.
plant     1 MKVVAAFLLAVLSGKASPTTGDIKDILGSGIMVLVLDCVVIGDCFGAETEDSQIELLLKEVKGKD 65

  Fly    51 IDDLIKEGREKLSSMPVGGGGAVAAADAAPAAAAGG--DKKEAKKEEKKEESESEDDDMGFALFE 113
            :.:||..|||||:|:|.||||.||.|.|......||  ...|:||||||||.|..||||||:|||
plant    66 LAELIAAGREKLASVPSGGGGGVAVASATSGGGGGGGAPAAESKKEEKKEEKEESDDDMGFSLFE 130

  Fly   114  113
            plant   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP2NP_523764.1 Ribosomal_P2 1..>65 CDD:100111 30/78 (38%)
AT2G27720NP_001154535.1 Ribosomal_P1_P2_L12p 1..130 CDD:304398 59/128 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2621
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I1952
OMA 1 1.010 - - QHG53848
OrthoDB 1 1.010 - - D1626327at2759
OrthoFinder 1 1.000 - - FOG0000927
OrthoInspector 1 1.000 - - otm2620
orthoMCL 1 0.900 - - OOG6_100883
Panther 1 1.100 - - LDO PTHR21141
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X755
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.070

Return to query results.
Submit another query.