DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP2 and Rplp2

DIOPT Version :10

Sequence 1:NP_523764.1 Gene:RpLP2 / 36855 FlyBaseID:FBgn0003274 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_080296.3 Gene:Rplp2 / 67186 MGIID:1914436 Length:115 Species:Mus musculus


Alignment Length:115 Identity:69/115 - (60%)
Similarity:85/115 - (73%) Gaps:2/115 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKLSSM 65
            |||||:||||.|||..||:..|::|||.|||:|.|.:||.|||.||.||:|:|:|.:|..||:|:
Mouse     1 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGVGKLASV 65

  Fly    66 PVGGGGAVAAA--DAAPAAAAGGDKKEAKKEEKKEESESEDDDMGFALFE 113
            |.||..||:||  .|||||.:.....|.||:|||||||..||||||.||:
Mouse    66 PAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP2NP_523764.1 Ribosomal_P2 1..>65 CDD:100111 38/63 (60%)
Rplp2NP_080296.3 Ribosomal_P2 1..>66 CDD:100111 39/64 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..115 23/38 (61%)

Return to query results.
Submit another query.