DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP2 and rplp2b

DIOPT Version :10

Sequence 1:NP_523764.1 Gene:RpLP2 / 36855 FlyBaseID:FBgn0003274 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001093906.1 Gene:rplp2b / 558312 ZFINID:ZDB-GENE-070327-2 Length:114 Species:Danio rerio


Alignment Length:115 Identity:67/115 - (58%)
Similarity:88/115 - (76%) Gaps:3/115 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKLSSM 65
            ||||||||||.|||||||:..|::|||.|||:|.|..|::||:.||.||:::::|.:|..||:|:
Zfish     1 MRYVAAYLLAALGGKDSPSTGDIKKILESVGIEADDVRMSKVVAELNGKNVEEVIAQGFSKLASV 65

  Fly    66 PVGGGGAVAAADAAPAA--AAGGDKKEAKKEEKKEESESEDDDMGFALFE 113
            |.||..||::| |||::  :|.....|.||||||||||..||||||.||:
Zfish    66 PSGGAVAVSSA-AAPSSGGSAAAPAAEEKKEEKKEESEESDDDMGFGLFD 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP2NP_523764.1 Ribosomal_P2 1..>65 CDD:100111 37/63 (59%)
rplp2bNP_001093906.1 Ribosomal_P2 1..114 CDD:100111 66/113 (58%)

Return to query results.
Submit another query.