DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP2 and rplp2

DIOPT Version :9

Sequence 1:NP_523764.1 Gene:RpLP2 / 36855 FlyBaseID:FBgn0003274 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001016645.1 Gene:rplp2 / 549399 XenbaseID:XB-GENE-944337 Length:115 Species:Xenopus tropicalis


Alignment Length:115 Identity:74/115 - (64%)
Similarity:87/115 - (75%) Gaps:2/115 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKLSSM 65
            ||||||||||||||.:||:.:||.|||||||:|.|.:|..||:|||.|||||::|.:|..||:||
 Frog     1 MRYVAAYLLAVLGGTESPSIADLTKILSSVGIETDQQRAEKVVKELKGKSIDEVIAQGNTKLASM 65

  Fly    66 PVGGGGAVAAADAAPAAAAGGD--KKEAKKEEKKEESESEDDDMGFALFE 113
            |.||..|.||:..:.|.||||.  ..|.||||||||||..||||||.||:
 Frog    66 PSGGAVAAAASGGSAAPAAGGSAAPAEEKKEEKKEESEESDDDMGFGLFD 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP2NP_523764.1 Ribosomal_P2 1..>65 CDD:100111 42/63 (67%)
rplp2NP_001016645.1 Ribosomal_P2 1..115 CDD:100111 73/113 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I6142
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I4380
OMA 1 1.010 - - QHG53848
OrthoDB 1 1.010 - - D1626327at2759
OrthoFinder 1 1.000 - - FOG0000927
OrthoInspector 1 1.000 - - oto104615
Panther 1 1.100 - - LDO PTHR21141
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1147
SonicParanoid 1 1.000 - - X755
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.