DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP2 and RpLP0

DIOPT Version :9

Sequence 1:NP_523764.1 Gene:RpLP2 / 36855 FlyBaseID:FBgn0003274 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001262202.1 Gene:RpLP0 / 40451 FlyBaseID:FBgn0000100 Length:317 Species:Drosophila melanogaster


Alignment Length:43 Identity:27/43 - (62%)
Similarity:30/43 - (69%) Gaps:3/43 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 AVAAADAAPAAAAGGDKK-EAKKEEKKEESESEDDDMGFALFE 113
            |.|:|.|||||....:|| ||||.|  .|||.|||||||.||:
  Fly   277 AAASASAAPAAGGATEKKEEAKKPE--SESEEEDDDMGFGLFD 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP2NP_523764.1 Ribosomal_P2 1..>65 CDD:100111
RpLP0NP_001262202.1 PTZ00135 1..275 CDD:240285
Ribosomal_P0_L10e 8..182 CDD:240221
Ribosomal_60s 232..>285 CDD:278836 4/7 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467274
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.