powered by:
Protein Alignment RpLP2 and RpLP0
DIOPT Version :9
Sequence 1: | NP_523764.1 |
Gene: | RpLP2 / 36855 |
FlyBaseID: | FBgn0003274 |
Length: | 113 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001262202.1 |
Gene: | RpLP0 / 40451 |
FlyBaseID: | FBgn0000100 |
Length: | 317 |
Species: | Drosophila melanogaster |
Alignment Length: | 43 |
Identity: | 27/43 - (62%) |
Similarity: | 30/43 - (69%) |
Gaps: | 3/43 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 AVAAADAAPAAAAGGDKK-EAKKEEKKEESESEDDDMGFALFE 113
|.|:|.|||||....:|| ||||.| .|||.|||||||.||:
Fly 277 AAASASAAPAAGGATEKKEEAKKPE--SESEEEDDDMGFGLFD 317
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45467274 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.