DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP2 and rplp2

DIOPT Version :9

Sequence 1:NP_523764.1 Gene:RpLP2 / 36855 FlyBaseID:FBgn0003274 Length:113 Species:Drosophila melanogaster
Sequence 2:XP_021332463.1 Gene:rplp2 / 335629 ZFINID:ZDB-GENE-031018-2 Length:148 Species:Danio rerio


Alignment Length:118 Identity:66/118 - (55%)
Similarity:81/118 - (68%) Gaps:8/118 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKLSSM 65
            ||||||||||||||..:|:..|::.||.|||:|.|.|||.||:.||.||.|::::..|..||:|:
Zfish    34 MRYVAAYLLAVLGGNTNPSAKDIKNILGSVGIEADDERLNKVVSELNGKDINEVMNAGLSKLASV 98

  Fly    66 PVGGGGAVAAADA-----APAAAAGGDKKEAKKEEKKEESESEDDDMGFALFE 113
            |.||..||:.|.|     |||.|...   |.||||||||||..|:||||.||:
Zfish    99 PAGGAVAVSTASAGGGGGAPAEAPAA---EEKKEEKKEESEESDEDMGFGLFD 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP2NP_523764.1 Ribosomal_P2 1..>65 CDD:100111 36/63 (57%)
rplp2XP_021332463.1 Ribosomal_P2 34..148 CDD:100111 65/116 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581893
Domainoid 1 1.000 98 1.000 Domainoid score I7116
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4633
OMA 1 1.010 - - QHG53848
OrthoDB 1 1.010 - - D1626327at2759
OrthoFinder 1 1.000 - - FOG0000927
OrthoInspector 1 1.000 - - otm25980
orthoMCL 1 0.900 - - OOG6_100883
Panther 1 1.100 - - LDO PTHR21141
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1147
SonicParanoid 1 1.000 - - X755
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.