DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP2 and RpLP1

DIOPT Version :9

Sequence 1:NP_523764.1 Gene:RpLP2 / 36855 FlyBaseID:FBgn0003274 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001259822.1 Gene:RpLP1 / 33214 FlyBaseID:FBgn0002593 Length:112 Species:Drosophila melanogaster


Alignment Length:108 Identity:45/108 - (41%)
Similarity:56/108 - (51%) Gaps:19/108 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKLSSMPVGGG-GA 72
            :||.|.|       :..||.:..|||:........|.|.|.::.|||..         :|.| ||
  Fly    21 VAVTGEK-------INTILKAANVEVEPYWPGLFAKALEGINVKDLITN---------IGSGVGA 69

  Fly    73 VAAADAAPAAAAGGDKKEAKKEEKKEESESE--DDDMGFALFE 113
            ..|..|||||||.....|:||||||:|.||:  ||||||.||:
  Fly    70 APAGGAAPAAAAAAPAAESKKEEKKKEEESDQSDDDMGFGLFD 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP2NP_523764.1 Ribosomal_P2 1..>65 CDD:100111 15/55 (27%)
RpLP1NP_001259822.1 Ribosomal_P1 6..111 CDD:100109 43/105 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467277
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.