DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP2 and rpp203

DIOPT Version :9

Sequence 1:NP_523764.1 Gene:RpLP2 / 36855 FlyBaseID:FBgn0003274 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_594358.1 Gene:rpp203 / 2543051 PomBaseID:SPAC1071.08 Length:110 Species:Schizosaccharomyces pombe


Alignment Length:115 Identity:66/115 - (57%)
Similarity:86/115 - (74%) Gaps:7/115 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKLSSM 65
            |:|:|||||..:|||:||:.||:|.:||:||:|.::||:..:||||.||.||:||..|.|||:::
pombe     1 MKYLAAYLLLTVGGKNSPSASDIESVLSTVGIESESERVEALIKELDGKDIDELIAAGNEKLATV 65

  Fly    66 PVGGGGAVAAADAAPAAAAGG--DKKEAKKEEKKEESESEDDDMGFALFE 113
            |.||    |||.||||||.|.  ..:||.|||.|||.|| |:||||.||:
pombe    66 PSGG----AAAAAAPAAAGGAAPAAEEAAKEEAKEEEES-DEDMGFGLFD 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP2NP_523764.1 Ribosomal_P2 1..>65 CDD:100111 36/63 (57%)
rpp203NP_594358.1 Ribosomal_P2 1..110 CDD:100111 65/113 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I1868
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I1463
OMA 1 1.010 - - QHG53848
OrthoFinder 1 1.000 - - FOG0000927
OrthoInspector 1 1.000 - - otm47340
orthoMCL 1 0.900 - - OOG6_100883
Panther 1 1.100 - - LDO PTHR21141
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1147
SonicParanoid 1 1.000 - - X755
TreeFam 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.