DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP2 and rla-2

DIOPT Version :9

Sequence 1:NP_523764.1 Gene:RpLP2 / 36855 FlyBaseID:FBgn0003274 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001370088.1 Gene:rla-2 / 178297 WormBaseID:WBGene00004410 Length:110 Species:Caenorhabditis elegans


Alignment Length:113 Identity:64/113 - (56%)
Similarity:76/113 - (67%) Gaps:3/113 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKLSSM 65
            ||||:|||||||||..:|...||:.|||:|||:.|||....|:..||||::::||.||...|.|:
 Worm     1 MRYVSAYLLAVLGGNANPKVDDLKNILSAVGVDADAETAKLVVSRLAGKTVEELIAEGSAGLVSV 65

  Fly    66 PVGGGGAVAAADAAPAAAAGGDKKEAKKEEKKEESESEDDDMGFALFE 113
            ..|...|.|||.||..||...|.|.|||||.||||   ||||||.||:
 Worm    66 SGGAAPAAAAAPAAGGAAPAADSKPAKKEEPKEES---DDDMGFGLFD 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP2NP_523764.1 Ribosomal_P2 1..>65 CDD:100111 35/63 (56%)
rla-2NP_001370088.1 Ribosomal_P2 1..110 CDD:100111 63/111 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I4966
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I3408
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53848
OrthoDB 1 1.010 - - D1626327at2759
OrthoFinder 1 1.000 - - FOG0000927
OrthoInspector 1 1.000 - - otm14599
orthoMCL 1 0.900 - - OOG6_100883
Panther 1 1.100 - - O PTHR21141
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1147
SonicParanoid 1 1.000 - - X755
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.