DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP2 and rplp-2.1

DIOPT Version :10

Sequence 1:NP_523764.1 Gene:RpLP2 / 36855 FlyBaseID:FBgn0003274 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_491944.2 Gene:rplp-2.1 / 172401 WormBaseID:WBGene00016493 Length:107 Species:Caenorhabditis elegans


Alignment Length:113 Identity:55/113 - (48%)
Similarity:73/113 - (64%) Gaps:6/113 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKLSSM 65
            |:|:.|||||.|||..||:..|:.|:|.:.|::.|.|....|:..|.||:|.::|.:|:.||||:
 Worm     1 MKYLGAYLLATLGGNASPSAQDVLKVLEAGGLDCDMENANSVVDALKGKTISEVIAQGKVKLSSV 65

  Fly    66 PVGGGGAVAAADAAPAAAAGGDKKEAKKEEKKEESESEDDDMGFALFE 113
            |.||.   |.|.|||:..|....:|.||||.||||   ||||||.||:
 Worm    66 PSGGS---APAAAAPSGGAAPKAEEKKKEEPKEES---DDDMGFGLFD 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP2NP_523764.1 Ribosomal_P2 1..>65 CDD:100111 28/63 (44%)
rplp-2.1NP_491944.2 Ribosomal_P2 1..107 CDD:100111 54/111 (49%)

Return to query results.
Submit another query.