DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP2 and Rplp2

DIOPT Version :9

Sequence 1:NP_523764.1 Gene:RpLP2 / 36855 FlyBaseID:FBgn0003274 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001025192.1 Gene:Rplp2 / 140662 RGDID:621775 Length:115 Species:Rattus norvegicus


Alignment Length:115 Identity:69/115 - (60%)
Similarity:85/115 - (73%) Gaps:2/115 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKLSSM 65
            |||||:||||.|||..:|:..|::|||.|||:|.|.|||.|||.||.||:|:|:|.:|..||:|:
  Rat     1 MRYVASYLLAALGGNSNPSAKDIKKILDSVGIEADDERLNKVISELNGKNIEDVIAQGVGKLASV 65

  Fly    66 PVGGGGAVAAA--DAAPAAAAGGDKKEAKKEEKKEESESEDDDMGFALFE 113
            |.||..||:||  .|||||.:.....|.||:|||||||..||||||.||:
  Rat    66 PAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP2NP_523764.1 Ribosomal_P2 1..>65 CDD:100111 38/63 (60%)
Rplp2NP_001025192.1 Ribosomal_P2 1..>66 CDD:100111 39/64 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..115 23/38 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341860
Domainoid 1 1.000 108 1.000 Domainoid score I6288
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4519
OMA 1 1.010 - - QHG53848
OrthoDB 1 1.010 - - D1626327at2759
OrthoFinder 1 1.000 - - FOG0000927
OrthoInspector 1 1.000 - - otm45922
orthoMCL 1 0.900 - - OOG6_100883
Panther 1 1.100 - - LDO PTHR21141
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X755
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.