DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpLP2 and XB5843130

DIOPT Version :9

Sequence 1:NP_523764.1 Gene:RpLP2 / 36855 FlyBaseID:FBgn0003274 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001107326.1 Gene:XB5843130 / 100135138 XenbaseID:XB-GENE-5843131 Length:111 Species:Xenopus tropicalis


Alignment Length:113 Identity:65/113 - (57%)
Similarity:85/113 - (75%) Gaps:2/113 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKLSSM 65
            |||||||||||||||.||:.:|::.||.|||::.|.||:.|||.||:||.::|::..|..||||:
 Frog     1 MRYVAAYLLAVLGGKTSPSANDIKSILKSVGIDADDERVKKVISELSGKDLEDVVNSGLAKLSSV 65

  Fly    66 PVGGGGAVAAADAAPAAAAGGDKKEAKKEEKKEESESEDDDMGFALFE 113
            |  .||||:||.|:..||.|....|.|:|:|:||||..|:||||.||:
 Frog    66 P--SGGAVSAAPASAPAAGGAAPAEKKEEKKEEESEESDEDMGFGLFD 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpLP2NP_523764.1 Ribosomal_P2 1..>65 CDD:100111 38/63 (60%)
XB5843130NP_001107326.1 Ribosomal_P2 1..>68 CDD:100111 40/68 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53848
OrthoDB 1 1.010 - - D1626327at2759
OrthoFinder 1 1.000 - - FOG0000927
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21141
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1147
SonicParanoid 1 1.000 - - X755
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.