DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and CDK1

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001307847.1 Gene:CDK1 / 983 HGNCID:1722 Length:297 Species:Homo sapiens


Alignment Length:296 Identity:128/296 - (43%)
Similarity:176/296 - (59%) Gaps:19/296 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLREISLLKQLNASNHANIV 89
            :|.::..||||.||.||:.|...||.:||:||:|:...|.|||.:.:|||||||:|   .|.|||
Human     3 DYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKEL---RHPNIV 64

  Fly    90 KLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSG-MSPPTIQRLSRELLTGVDFLHSHRI 153
            .|.:|   |.:|.:|  .|:||.:..||...:|.:|... |....::....::|.|:.|.||.|:
Human    65 SLQDV---LMQDSRL--YLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRV 124

  Fly   154 IHRDLKPQNLLVSSQGHLKIADFGLAKTYGSEMKL-TSVVVTLWYRAPEVLLAQP-YNSTVDIWS 216
            :||||||||||:..:|.:|:||||||:.:|..::: |..|||||||:|||||... |::.|||||
Human   125 LHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWS 189

  Fly   217 AACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISVALEHFPQRHPK-RPKDFCPH 280
            ...|..|:..::.||.|.||.:||.|||...|.|..:.||:..|  |:.:....|| :|.....|
Human   190 IGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVES--LQDYKNTFPKWKPGSLASH 252

  Fly   281 LCKYAD----DLLNKMLSYDLHLRPSALACLEHDYF 312
            : |..|    |||:|||.||...|.|....|.|.||
Human   253 V-KNLDENGLDLLSKMLIYDPAKRISGKMALNHPYF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 126/293 (43%)
S_TKc 26..312 CDD:214567 126/293 (43%)
CDK1NP_001307847.1 STKc_CDK1_euk 3..287 CDD:270845 126/294 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.