DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and Cdk4

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_038935924.1 Gene:Cdk4 / 94201 RGDID:621120 Length:313 Species:Rattus norvegicus


Alignment Length:227 Identity:105/227 - (46%)
Similarity:147/227 - (64%) Gaps:0/227 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSGMSPPTIQRLSRELLTGVDFLHSHRI 153
            |:|.:||.....|..:.:.|||||::|||...:|:.|..|:...||:.|.|:.|:|:||||::.|
  Rat    82 VRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDFLHANCI 146

  Fly   154 IHRDLKPQNLLVSSQGHLKIADFGLAKTYGSEMKLTSVVVTLWYRAPEVLLAQPYNSTVDIWSAA 218
            :||||||:|:||:|.|.:|:||||||:.|..:|.||.||||||||||||||...|.:.||:||..
  Rat   147 VHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVG 211

  Fly   219 CIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISVALEHFPQRHPKRPKDFCPHLCK 283
            ||..|||.|:.||.|.||.:||.:||:|.|.|.|..||:.:|:....|..|.|:..:...|.:.:
  Rat   212 CIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPREVSLPRGAFSPRGPRPVQSVVPEMEE 276

  Fly   284 YADDLLNKMLSYDLHLRPSALACLEHDYFQQE 315
            ....||.:||:::...|.||...|:|.|..:|
  Rat   277 SGAQLLLEMLTFNPLKRISAFRALQHSYLHKE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 103/222 (46%)
S_TKc 26..312 CDD:214567 103/222 (46%)
Cdk4XP_038935924.1 PKc_like <82..305 CDD:419665 103/222 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 277 1.000 Domainoid score I1657
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 279 1.000 Inparanoid score I2838
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D419040at33208
OrthoFinder 1 1.000 - - FOG0004605
OrthoInspector 1 1.000 - - otm45619
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2222
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.