DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and PHO85

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_015294.1 Gene:PHO85 / 856076 SGDID:S000005952 Length:305 Species:Saccharomyces cerevisiae


Alignment Length:318 Identity:119/318 - (37%)
Similarity:188/318 - (59%) Gaps:34/318 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MSQAKKFGDGDPFNYQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNENGVPMSTLREISL 76
            ||.:.:|        ::|..:|.|.|.|||:..:..||..||||:|::. :|.|.|.:.:|||||
Yeast     1 MSSSSQF--------KQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLD-SEEGTPSTAIREISL 56

  Fly    77 LKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLID-----RLPKSGMSPPTIQR 136
            :|:|   .|.|||:||:|   :..:.:|  .||||.::.||...:|     ..|: |:....::.
Yeast    57 MKEL---KHENIVRLYDV---IHTENKL--TLVFEFMDNDLKKYMDSRTVGNTPR-GLELNLVKY 112

  Fly   137 LSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAKTYGSEMK-LTSVVVTLWYRAP 200
            ...:||.|:.|.|.::|:||||||||||::.:|.||:.|||||:.:|..:. .:|.|||||||||
Yeast   113 FQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAP 177

  Fly   201 EVLL-AQPYNSTVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISVALE 264
            :||: ::.|::::||||..||:.||...:.|||||:::.||..||::.|.|.|..|| :::...:
Yeast   178 DVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWP-SVTKLPK 241

  Fly   265 HFPQRHPKRPKD----FCPHLCKYAD----DLLNKMLSYDLHLRPSALACLEHDYFQQ 314
            :.|....:.|:|    ..||..:..|    |.|:.:|..:..:|.||...|.|.:|.:
Yeast   242 YNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWFAE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 115/300 (38%)
S_TKc 26..312 CDD:214567 115/300 (38%)
PHO85NP_015294.1 PKc_like 6..297 CDD:419665 116/309 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.