DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and KDX1

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_012761.1 Gene:KDX1 / 853696 SGDID:S000001644 Length:433 Species:Saccharomyces cerevisiae


Alignment Length:298 Identity:92/298 - (30%)
Similarity:148/298 - (49%) Gaps:27/298 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IGEGAYGTV----YRARDVITGNIVALKKVRISLNENGVPMS---TLREISLLKQLNASNHANIV 89
            ||.|::..:    |...:..|.  ||::|:.   |..|..:|   ||||:.||:.|.  .|.|||
Yeast    29 IGRGSHSLICSSTYTESNEETH--VAIRKIP---NAFGNKLSCKRTLRELKLLRHLR--GHPNIV 86

  Fly    90 KLYEVCQFLERDGQLLILLVFEH-VEQDLSDLIDRLPKSGMSPPTIQRLSRELLTGVDFLHSHRI 153
            .|::.......:|.|..:.::|. :|.|||.:|  ..:..:.....|....::|..:.::||..:
Yeast    87 WLFDTDIVFYPNGALNGVYLYEELMECDLSQII--RSEQRLEDAHFQSFIYQILCALKYIHSANV 149

  Fly   154 IHRDLKPQNLLVSSQGHLKIADFGLAKTYGSEMK-----LTSVVVTLWYRAPEVLL-AQPYNSTV 212
            :|.||||:||||:|...|||.:|||:.:|....|     :...:.::||:|||:|| .|.....|
Yeast   150 LHCDLKPKNLLVNSDCQLKICNFGLSCSYSENHKVNDGFIKGYITSIWYKAPEILLNYQECTKAV 214

  Fly   213 DIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISVALEHFPQRHPKRP--- 274
            ||||..||:.|:..|:.:|.|....:.|:.|.::.|.|.|:...:..|..:.::..:....|   
Yeast   215 DIWSTGCILAELLGRKPMFEGKDYVDHLNHILQILGTPPEETLQEIASQKVYNYIFQFGNIPGRS 279

  Fly   275 -KDFCPHLCKYADDLLNKMLSYDLHLRPSALACLEHDY 311
             :...|.....|.:||.|||.:|...|.:....|||.|
Yeast   280 FESILPGANPEALELLKKMLEFDPKKRITVEDALEHPY 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 92/298 (31%)
S_TKc 26..312 CDD:214567 92/298 (31%)
KDX1NP_012761.1 STKc_MPK1 22..355 CDD:173750 92/298 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.