DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk4 and CDC28

DIOPT Version :9

Sequence 1:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_009718.3 Gene:CDC28 / 852457 SGDID:S000000364 Length:298 Species:Saccharomyces cerevisiae


Alignment Length:302 Identity:128/302 - (42%)
Similarity:181/302 - (59%) Gaps:15/302 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GDPFNYQELNIIGEGAYGTVYRARDVITG---NIVALKKVRISLNENGVPMSTLREISLLKQLNA 82
            |:..||:.|..:|||.||.||:|.|:..|   .:|||||:|:...:.|||.:.:|||||||:|..
Yeast     3 GELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKD 67

  Fly    83 SNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPK-SGMSPPTIQRLSRELLTGVD 146
            .   |||:||::   :..|...| .||||.::.||...::.:|| ..:....:::...:|..|:.
Yeast    68 D---NIVRLYDI---VHSDAHKL-YLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQLCKGIA 125

  Fly   147 FLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAKTYGSEMK-LTSVVVTLWYRAPEVLL-AQPYN 209
            :.|||||:||||||||||::..|:||:.|||||:.:|..:: .|..:|||||||||||| .:.|:
Yeast   126 YCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGKQYS 190

  Fly   210 STVDIWSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISVA--LEHFPQRHPK 272
            :.||.||..||..||.||:.:|.|.||.:|:.:||.:.|.|.|..||..:.:.  ...|||...|
Yeast   191 TGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIVYLPDFKPSFPQWRRK 255

  Fly   273 RPKDFCPHLCKYADDLLNKMLSYDLHLRPSALACLEHDYFQQ 314
            ......|.|.....|||:|:|:||...|.||.....|.|||:
Yeast   256 DLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 123/293 (42%)
S_TKc 26..312 CDD:214567 123/293 (42%)
CDC28NP_009718.3 STKc_CDK1_CdkB_like 8..295 CDD:270829 123/293 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.